IVF0013717 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCAGAAGTTCGTTCAAACTTGGAATTCCTCTGGGTAATCATCTATTTTTAGTTTCACTTGAATTGCTTAGAATTTGATTGATTTTGTGACCTTAATTGTATTCGTGTTCTGTTTGTTCCTCTTTTGGGTAATTCTGCTTTGGTAAAATCTAACTGGCTACAATCAGAATTATGTGATATTTAATGCTTTAATTATTATTGCTTACTCTGTTGGGATGTTCACTTCTCAGAAAAGAGGCAGGCTGAAGCTGCTCGTATAAGAGAGAAGTACCCGGATAGAATACCTGTATGAATAATGTTACTGATTTAGTTCACTTCGTATGGTGTTCTAATATTTTTTTGGTTTTGGTGCTGACGCAATTAAGTTAATCAGGTGATTGTCGAGAAAGCTGGGAGGAGTGACATTGCTGACATTGATAGGAACAAGTACCTCTCTTTTTCTCTATTCTCTTCATGAATTGGTGCATTAGCATAAATTGATGATGAGATGTTACCGCATTCTTAACTGATAAATTAAAGTAGAAACTAGCATATATGTTAGTAGCAGCTGCAGTAATATGTCAGAATGAAAATAATGGAGTTGATAGCATGTAGTTTGAATGTCATTTTGGAAGTTTCCAATATCATATAATTGAACAGTTCTCATTTAGTGTGGTGTGGCATTTTTTTATCTTTCCCATTGCAGATACCTCGTCCCTACGGATTTAACTGTTGGACAGTTTGTTTACGTTGTTCGGAAACGGATTAAGCTTAGTGCTGAGAAAGCTATATTTGTTTTTGTGAAGGACACTCTACCATCAACTGGTGAGTGAAGATGACCCCTTTTATCTTAATCTCTGATCTTGTATTGAATGTAAGCTTTAAAATAAATTCTTCTGTGCAACAGGTGCATTGATGTCTGCAATTTATGCGGATAATAAGGACGAAGATGGTTTTCTTTACATGTCATACAGTGGAGAAAACACTTTTGGTGGGTTCCTTGGAGGACAATGA ATGGCCAGAAGTTCGTTCAAACTTGGAATTCCTCTGGAAAAGAGGCAGGCTGAAGCTGCTCGTATAAGAGAGAAGTACCCGGATAGAATACCTGTGATTGTCGAGAAAGCTGGGAGGAGTGACATTGCTGACATTGATAGGAACAAATACCTCGTCCCTACGGATTTAACTGTTGGACAGTTTGTTTACGTTGTTCGGAAACGGATTAAGCTTAGTGCTGAGAAAGCTATATTTGTTTTTGTGAAGGACACTCTACCATCAACTGGTGCATTGATGTCTGCAATTTATGCGGATAATAAGGACGAAGATGGTTTTCTTTACATGTCATACAGTGGAGAAAACACTTTTGGTGGGTTCCTTGGAGGACAATGA ATGGCCAGAAGTTCGTTCAAACTTGGAATTCCTCTGGAAAAGAGGCAGGCTGAAGCTGCTCGTATAAGAGAGAAGTACCCGGATAGAATACCTGTGATTGTCGAGAAAGCTGGGAGGAGTGACATTGCTGACATTGATAGGAACAAATACCTCGTCCCTACGGATTTAACTGTTGGACAGTTTGTTTACGTTGTTCGGAAACGGATTAAGCTTAGTGCTGAGAAAGCTATATTTGTTTTTGTGAAGGACACTCTACCATCAACTGGTGCATTGATGTCTGCAATTTATGCGGATAATAAGGACGAAGATGGTTTTCTTTACATGTCATACAGTGGAGAAAACACTTTTGGTGGGTTCCTTGGAGGACAATGA MARSSFKLGIPLEKRQAEAARIREKYPDRIPVIVEKAGRSDIADIDRNKYLVPTDLTVGQFVYVVRKRIKLSAEKAIFVFVKDTLPSTGALMSAIYADNKDEDGFLYMSYSGENTFGGFLGGQ Homology
BLAST of IVF0013717 vs. ExPASy Swiss-Prot
Match: A2YS06 (Autophagy-related protein 8C OS=Oryza sativa subsp. indica OX=39946 GN=ATG8C PE=3 SV=2) HSP 1 Score: 199.1 bits (505), Expect = 2.8e-50 Identity = 102/120 (85.00%), Postives = 109/120 (90.83%), Query Frame = 0
BLAST of IVF0013717 vs. ExPASy Swiss-Prot
Match: Q6Z1D5 (Autophagy-related protein 8C OS=Oryza sativa subsp. japonica OX=39947 GN=ATG8C PE=2 SV=1) HSP 1 Score: 199.1 bits (505), Expect = 2.8e-50 Identity = 102/120 (85.00%), Postives = 109/120 (90.83%), Query Frame = 0
BLAST of IVF0013717 vs. ExPASy Swiss-Prot
Match: M1C146 (Autophagy-related protein 8C-like OS=Solanum tuberosum OX=4113 GN=ATG8CL PE=1 SV=1) HSP 1 Score: 196.1 bits (497), Expect = 2.4e-49 Identity = 99/119 (83.19%), Postives = 108/119 (90.76%), Query Frame = 0
BLAST of IVF0013717 vs. ExPASy Swiss-Prot
Match: Q8LEM4 (Autophagy-related protein 8a OS=Arabidopsis thaliana OX=3702 GN=ATG8A PE=1 SV=2) HSP 1 Score: 190.7 bits (483), Expect = 1.0e-47 Identity = 94/117 (80.34%), Postives = 106/117 (90.60%), Query Frame = 0
BLAST of IVF0013717 vs. ExPASy Swiss-Prot
Match: Q8S927 (Autophagy-related protein 8c OS=Arabidopsis thaliana OX=3702 GN=ATG8C PE=1 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 1.7e-47 Identity = 95/117 (81.20%), Postives = 106/117 (90.60%), Query Frame = 0
BLAST of IVF0013717 vs. ExPASy TrEMBL
Match: A0A1S3B043 (Autophagy-related protein OS=Cucumis melo OX=3656 GN=LOC103484614 PE=3 SV=1) HSP 1 Score: 240.7 bits (613), Expect = 3.1e-60 Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 0
BLAST of IVF0013717 vs. ExPASy TrEMBL
Match: A0A5D3CPT6 (Autophagy-related protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G006460 PE=3 SV=1) HSP 1 Score: 240.7 bits (613), Expect = 3.1e-60 Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 0
BLAST of IVF0013717 vs. ExPASy TrEMBL
Match: A0A0A0KJW7 (Autophagy-related protein OS=Cucumis sativus OX=3659 GN=Csa_6G513730 PE=3 SV=1) HSP 1 Score: 233.4 bits (594), Expect = 5.0e-58 Identity = 120/123 (97.56%), Postives = 120/123 (97.56%), Query Frame = 0
BLAST of IVF0013717 vs. ExPASy TrEMBL
Match: A0A6J1GDU9 (Autophagy-related protein OS=Cucurbita moschata OX=3662 GN=LOC111453258 PE=3 SV=1) HSP 1 Score: 224.9 bits (572), Expect = 1.8e-55 Identity = 113/123 (91.87%), Postives = 118/123 (95.93%), Query Frame = 0
BLAST of IVF0013717 vs. ExPASy TrEMBL
Match: A0A6J1CL79 (Autophagy-related protein OS=Momordica charantia OX=3673 GN=LOC111012314 PE=3 SV=1) HSP 1 Score: 222.6 bits (566), Expect = 8.9e-55 Identity = 115/123 (93.50%), Postives = 120/123 (97.56%), Query Frame = 0
BLAST of IVF0013717 vs. NCBI nr
Match: XP_008439996.1 (PREDICTED: autophagy-related protein 8C [Cucumis melo] >XP_008439997.1 PREDICTED: autophagy-related protein 8C [Cucumis melo] >XP_016899344.1 PREDICTED: autophagy-related protein 8C [Cucumis melo] >TYK13044.1 autophagy-related protein 8C [Cucumis melo var. makuwa]) HSP 1 Score: 239 bits (610), Expect = 2.15e-79 Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 0
BLAST of IVF0013717 vs. NCBI nr
Match: XP_004134765.1 (autophagy-related protein 8C [Cucumis sativus] >XP_011658146.1 autophagy-related protein 8C [Cucumis sativus] >XP_011658147.1 autophagy-related protein 8C [Cucumis sativus] >KGN49109.1 hypothetical protein Csa_003738 [Cucumis sativus]) HSP 1 Score: 232 bits (591), Expect = 1.70e-76 Identity = 120/123 (97.56%), Postives = 120/123 (97.56%), Query Frame = 0
BLAST of IVF0013717 vs. NCBI nr
Match: KAG6603779.1 (Autophagy-related protein 8C, partial [Cucurbita argyrosperma subsp. sororia] >KAG7033949.1 Autophagy-related protein 8C [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 224 bits (572), Expect = 1.35e-73 Identity = 114/123 (92.68%), Postives = 118/123 (95.93%), Query Frame = 0
BLAST of IVF0013717 vs. NCBI nr
Match: XP_022950063.1 (autophagy-related protein 8C-like [Cucurbita moschata]) HSP 1 Score: 223 bits (569), Expect = 3.86e-73 Identity = 113/123 (91.87%), Postives = 118/123 (95.93%), Query Frame = 0
BLAST of IVF0013717 vs. NCBI nr
Match: XP_022142105.1 (autophagy-related protein 8C-like [Momordica charantia] >XP_022142106.1 autophagy-related protein 8C-like [Momordica charantia]) HSP 1 Score: 221 bits (563), Expect = 5.74e-72 Identity = 115/123 (93.50%), Postives = 120/123 (97.56%), Query Frame = 0
BLAST of IVF0013717 vs. TAIR 10
Match: AT4G21980.1 (Ubiquitin-like superfamily protein ) HSP 1 Score: 190.7 bits (483), Expect = 7.2e-49 Identity = 94/117 (80.34%), Postives = 106/117 (90.60%), Query Frame = 0
BLAST of IVF0013717 vs. TAIR 10
Match: AT4G21980.2 (Ubiquitin-like superfamily protein ) HSP 1 Score: 190.7 bits (483), Expect = 7.2e-49 Identity = 94/117 (80.34%), Postives = 106/117 (90.60%), Query Frame = 0
BLAST of IVF0013717 vs. TAIR 10
Match: AT1G62040.1 (Ubiquitin-like superfamily protein ) HSP 1 Score: 189.9 bits (481), Expect = 1.2e-48 Identity = 95/117 (81.20%), Postives = 106/117 (90.60%), Query Frame = 0
BLAST of IVF0013717 vs. TAIR 10
Match: AT1G62040.2 (Ubiquitin-like superfamily protein ) HSP 1 Score: 189.9 bits (481), Expect = 1.2e-48 Identity = 95/117 (81.20%), Postives = 106/117 (90.60%), Query Frame = 0
BLAST of IVF0013717 vs. TAIR 10
Match: AT2G05630.1 (Ubiquitin-like superfamily protein ) HSP 1 Score: 188.7 bits (478), Expect = 2.7e-48 Identity = 97/119 (81.51%), Postives = 105/119 (88.24%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|