IVF0013576 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGCGGCTTCTTATGCCGGTTTTGATGGATCACCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCGCTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTACCAGTGTTGTTTCAGTTTGGTTGAGGTTTGA ATGGCTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGCGGCTTCTTATGCCGGTTTTGATGGATCACCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCGCTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTACCAGTGTTGTTTCAGTTTGGTTGAGGTTTGA ATGGCTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGCGGCTTCTTATGCCGGTTTTGATGGATCACCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCGCTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTACCAGTGTTGTTTCAGTTTGGTTGAGGTTTGA MAAMVRASSGLQYPDRFYAAASYAGFDGSPKLSSKALRSKFSDEAALLLYGLYQQVLPRVLTPVTYQCCFSLVEV Homology
BLAST of IVF0013576 vs. ExPASy Swiss-Prot
Match: Q8RWD9 (Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=ACBP5 PE=1 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 2.1e-11 Identity = 38/55 (69.09%), Postives = 44/55 (80.00%), Query Frame = 0
BLAST of IVF0013576 vs. ExPASy Swiss-Prot
Match: Q9MA55 (Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=ACBP4 PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 5.1e-10 Identity = 35/53 (66.04%), Postives = 40/53 (75.47%), Query Frame = 0
BLAST of IVF0013576 vs. ExPASy Swiss-Prot
Match: Q75LJ4 (Acyl-CoA-binding domain-containing protein 6 OS=Oryza sativa subsp. japonica OX=39947 GN=ACBP6 PE=2 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 1.5e-09 Identity = 37/66 (56.06%), Postives = 42/66 (63.64%), Query Frame = 0
BLAST of IVF0013576 vs. ExPASy TrEMBL
Match: A0A5A7VFV5 (Acyl-CoA-binding domain-containing protein 4 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold979G00450 PE=4 SV=1) HSP 1 Score: 146.0 bits (367), Expect = 6.4e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0013576 vs. ExPASy TrEMBL
Match: A0A5D3CJT5 (Acyl-CoA-binding domain-containing protein 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold828G00570 PE=4 SV=1) HSP 1 Score: 144.4 bits (363), Expect = 1.9e-31 Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0013576 vs. ExPASy TrEMBL
Match: A0A5D3C6F7 (Acyl-CoA-binding domain-containing protein 4 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold202G002100 PE=4 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 5.4e-31 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 0
BLAST of IVF0013576 vs. ExPASy TrEMBL
Match: A0A5A7SRV4 (Acyl-CoA-binding domain-containing protein 4 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold218G00010 PE=4 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 5.4e-31 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 0
BLAST of IVF0013576 vs. ExPASy TrEMBL
Match: A0A5A7TXT8 (Acyl-CoA-binding domain-containing protein 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold488G00610 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 1.6e-30 Identity = 71/75 (94.67%), Postives = 73/75 (97.33%), Query Frame = 0
BLAST of IVF0013576 vs. NCBI nr
Match: KAA0066628.1 (acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 144 bits (364), Expect = 9.53e-43 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0013576 vs. NCBI nr
Match: KAA0063418.1 (acyl-CoA-binding domain-containing protein 4 [Cucumis melo var. makuwa] >TYK11680.1 acyl-CoA-binding domain-containing protein 4 [Cucumis melo var. makuwa]) HSP 1 Score: 143 bits (360), Expect = 5.60e-42 Identity = 73/74 (98.65%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0013576 vs. NCBI nr
Match: KAA0025187.1 (acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa] >TYK07477.1 acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 141 bits (356), Expect = 6.93e-42 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 0
BLAST of IVF0013576 vs. NCBI nr
Match: KAA0031885.1 (acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 141 bits (356), Expect = 1.58e-41 Identity = 72/74 (97.30%), Postives = 73/74 (98.65%), Query Frame = 0
BLAST of IVF0013576 vs. NCBI nr
Match: TYK30810.1 (acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 135 bits (339), Expect = 1.47e-39 Identity = 69/75 (92.00%), Postives = 70/75 (93.33%), Query Frame = 0
BLAST of IVF0013576 vs. TAIR 10
Match: AT5G27630.1 (acyl-CoA binding protein 5 ) HSP 1 Score: 69.3 bits (168), Expect = 1.5e-12 Identity = 38/55 (69.09%), Postives = 44/55 (80.00%), Query Frame = 0
BLAST of IVF0013576 vs. TAIR 10
Match: AT3G05420.1 (acyl-CoA binding protein 4 ) HSP 1 Score: 64.7 bits (156), Expect = 3.6e-11 Identity = 35/53 (66.04%), Postives = 40/53 (75.47%), Query Frame = 0
BLAST of IVF0013576 vs. TAIR 10
Match: AT3G05420.2 (acyl-CoA binding protein 4 ) HSP 1 Score: 64.7 bits (156), Expect = 3.6e-11 Identity = 35/53 (66.04%), Postives = 40/53 (75.47%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|