![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
IVF0013261 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCCATTTCTTTCCTCCACCGCTTCTCTCTCGATCCCCCGCACTGCCGCACCGCCGCTAAATGGACTGCCCTATTAACGCTAACCGCCGCCGTGGCCTCCTTCGCTCCGGAGTTCATTTTCGCTAATGCAACGTCGCTCCATTCCTCCTTCTCCAGGTCCTGTCGGCGTGATGGCTACATCAGGATCCCACTCGACCTTCCGGCGATGTTCTGTGCTTGCCGGCGAACATGGTGAATCGATCCAGTTTGGATTTCTTCGTACCTACGGTTTTTGCGGCTCTCGGAGTTGGCGTTTCGGCTTGTTTCGTTAGATCCTTGGGATTGTGGGAAGAATTTTGA ATGCCCATTTCTTTCCTCCACCGCTTCTCTCTCGATCCCCCGCACTGCCGCACCGCCGCTAAATGGACTGCCCTATTAACGCTAACCGCCGCCGTGGCCTCCTTCGCTCCGGAGTTCATTTTCGCTAATGCAACGTCGCTCCATTCCTCCTTCTCCAGGTCCTGTCGGCGTGATGGCTACATCAGGATCCCACTCGACCTTCCGGCGATTTTGGATTTCTTCGTACCTACGGTTTTTGCGGCTCTCGGAGTTGGCGTTTCGGCTTGTTTCGTTAGATCCTTGGGATTGTGGGAAGAATTTTGA ATGCCCATTTCTTTCCTCCACCGCTTCTCTCTCGATCCCCCGCACTGCCGCACCGCCGCTAAATGGACTGCCCTATTAACGCTAACCGCCGCCGTGGCCTCCTTCGCTCCGGAGTTCATTTTCGCTAATGCAACGTCGCTCCATTCCTCCTTCTCCAGGTCCTGTCGGCGTGATGGCTACATCAGGATCCCACTCGACCTTCCGGCGATTTTGGATTTCTTCGTACCTACGGTTTTTGCGGCTCTCGGAGTTGGCGTTTCGGCTTGTTTCGTTAGATCCTTGGGATTGTGGGAAGAATTTTGA MPISFLHRFSLDPPHCRTAAKWTALLTLTAAVASFAPEFIFANATSLHSSFSRSCRRDGYIRIPLDLPAILDFFVPTVFAALGVGVSACFVRSLGLWEEF Homology
BLAST of IVF0013261 vs. ExPASy TrEMBL
Match: A0A5A7V3R2 (Forkhead box protein G1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold250G00490 PE=4 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 6.1e-46 Identity = 98/113 (86.73%), Postives = 99/113 (87.61%), Query Frame = 0
BLAST of IVF0013261 vs. ExPASy TrEMBL
Match: A0A1S3BKF6 (uncharacterized protein LOC103490587 OS=Cucumis melo OX=3656 GN=LOC103490587 PE=4 SV=1) HSP 1 Score: 193.0 bits (489), Expect = 6.1e-46 Identity = 98/113 (86.73%), Postives = 99/113 (87.61%), Query Frame = 0
BLAST of IVF0013261 vs. ExPASy TrEMBL
Match: A0A0A0KEV4 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G303790 PE=4 SV=1) HSP 1 Score: 166.8 bits (421), Expect = 4.7e-38 Identity = 87/109 (79.82%), Postives = 89/109 (81.65%), Query Frame = 0
BLAST of IVF0013261 vs. ExPASy TrEMBL
Match: A0A6J1D3X8 (uncharacterized protein LOC111017044 OS=Momordica charantia OX=3673 GN=LOC111017044 PE=4 SV=1) HSP 1 Score: 157.1 bits (396), Expect = 3.7e-35 Identity = 86/111 (77.48%), Postives = 88/111 (79.28%), Query Frame = 0
BLAST of IVF0013261 vs. ExPASy TrEMBL
Match: A0A2I4EV00 (uncharacterized protein LOC108992958 OS=Juglans regia OX=51240 GN=LOC108992958 PE=4 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 9.8e-20 Identity = 59/108 (54.63%), Postives = 68/108 (62.96%), Query Frame = 0
BLAST of IVF0013261 vs. NCBI nr
Match: XP_008448381.1 (PREDICTED: uncharacterized protein LOC103490587 [Cucumis melo] >KAA0061944.1 forkhead box protein G1 [Cucumis melo var. makuwa] >TYK23985.1 forkhead box protein G1 [Cucumis melo var. makuwa]) HSP 1 Score: 194 bits (494), Expect = 2.97e-62 Identity = 98/113 (86.73%), Postives = 99/113 (87.61%), Query Frame = 0
BLAST of IVF0013261 vs. NCBI nr
Match: XP_038900397.1 (uncharacterized protein LOC120087630 [Benincasa hispida]) HSP 1 Score: 186 bits (471), Expect = 9.58e-59 Identity = 93/113 (82.30%), Postives = 96/113 (84.96%), Query Frame = 0
BLAST of IVF0013261 vs. NCBI nr
Match: XP_031742493.1 (uncharacterized protein LOC105435838 [Cucumis sativus]) HSP 1 Score: 168 bits (426), Expect = 6.15e-52 Identity = 87/109 (79.82%), Postives = 89/109 (81.65%), Query Frame = 0
BLAST of IVF0013261 vs. NCBI nr
Match: KAE8647072.1 (hypothetical protein Csa_023019 [Cucumis sativus]) HSP 1 Score: 167 bits (422), Expect = 1.07e-50 Identity = 86/108 (79.63%), Postives = 88/108 (81.48%), Query Frame = 0
BLAST of IVF0013261 vs. NCBI nr
Match: KAG6570723.1 (hypothetical protein SDJN03_29638, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 160 bits (405), Expect = 1.42e-48 Identity = 84/112 (75.00%), Postives = 88/112 (78.57%), Query Frame = 0
BLAST of IVF0013261 vs. TAIR 10
Match: AT2G37530.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G07795.1); Has 39 Blast hits to 39 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 39; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 79.0 bits (193), Expect = 2.5e-15 Identity = 49/110 (44.55%), Postives = 59/110 (53.64%), Query Frame = 0
BLAST of IVF0013261 vs. TAIR 10
Match: AT1G07795.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT2G28725.1); Has 38 Blast hits to 38 proteins in 11 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 38; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 61.2 bits (147), Expect = 5.3e-10 Identity = 42/103 (40.78%), Postives = 52/103 (50.49%), Query Frame = 0
BLAST of IVF0013261 vs. TAIR 10
Match: AT2G28725.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G07795.1); Has 35 Blast hits to 35 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 35; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 54.7 bits (130), Expect = 5.0e-08 Identity = 36/87 (41.38%), Postives = 47/87 (54.02%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|