IVF0012656 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAAGGAAAGGAAAGTAGAATTTCTGTTGTTGTTGGGAATGTTGCCGATGAAATTCGCATCTGTGAAGTTCCAGCACTGAAAGCTCTAAGGCTCACTCAGACAGCAAGGTCAAGGATCGAAAAGGCTGGCTGGGAATGTTTGACATTTGACCAGCTTGCTTTTAGGGCTCATCTGGGTCAGAACACGGTTCTTCTTAGAGGTCCTAAGAACTCCCAAGAGGCATTAAAGCTTTTCGGTCCAGCACCTGCTGTGTCACACAGCCATTCCGAGCCATATGTGAGGTCTAATGGAAGGAATTTCGAGAGGGCTAGAGGAAAGAGGAACAGCAGGGGATATGGAGTTTGA ATGAAAGGAAAGGAAAGTAGAATTTCTGTTGTTGTTGGGAATGTTGCCGATGAAATTCGCATCTGTGAAGTTCCAGCACTGAAAGCTCTAAGGCTCACTCAGACAGCAAGGTCAAGGATCGAAAAGGCTGGCTGGGAATGTTTGACATTTGACCAGCTTGCTTTTAGGGCTCATCTGGGTCAGAACACGGTTCTTCTTAGAGGTCCTAAGAACTCCCAAGAGGCATTAAAGCTTTTCGGTCCAGCACCTGCTGTGTCACACAGCCATTCCGAGCCATATGTGAGGTCTAATGGAAGGAATTTCGAGAGGGCTAGAGGAAAGAGGAACAGCAGGGGATATGGAGTTTGA ATGAAAGGAAAGGAAAGTAGAATTTCTGTTGTTGTTGGGAATGTTGCCGATGAAATTCGCATCTGTGAAGTTCCAGCACTGAAAGCTCTAAGGCTCACTCAGACAGCAAGGTCAAGGATCGAAAAGGCTGGCTGGGAATGTTTGACATTTGACCAGCTTGCTTTTAGGGCTCATCTGGGTCAGAACACGGTTCTTCTTAGAGGTCCTAAGAACTCCCAAGAGGCATTAAAGCTTTTCGGTCCAGCACCTGCTGTGTCACACAGCCATTCCGAGCCATATGTGAGGTCTAATGGAAGGAATTTCGAGAGGGCTAGAGGAAAGAGGAACAGCAGGGGATATGGAGTTTGA MKGKESRISVVVGNVADEIRICEVPALKALRLTQTARSRIEKAGWECLTFDQLAFRAHLGQNTVLLRGPKNSQEALKLFGPAPAVSHSHSEPYVRSNGRNFERARGKRNSRGYGV Homology
BLAST of IVF0012656 vs. ExPASy Swiss-Prot
Match: P42791 (60S ribosomal protein L18-2 OS=Arabidopsis thaliana OX=3702 GN=RPL18B PE=1 SV=2) HSP 1 Score: 164.5 bits (415), Expect = 7.3e-40 Identity = 81/117 (69.23%), Postives = 98/117 (83.76%), Query Frame = 0
BLAST of IVF0012656 vs. ExPASy Swiss-Prot
Match: Q940B0 (60S ribosomal protein L18-3 OS=Arabidopsis thaliana OX=3702 GN=RPL18C PE=2 SV=1) HSP 1 Score: 158.7 bits (400), Expect = 4.0e-38 Identity = 78/117 (66.67%), Postives = 97/117 (82.91%), Query Frame = 0
BLAST of IVF0012656 vs. ExPASy Swiss-Prot
Match: O65729 (60S ribosomal protein L18 (Fragment) OS=Cicer arietinum OX=3827 GN=RPL18 PE=2 SV=1) HSP 1 Score: 149.1 bits (375), Expect = 3.2e-35 Identity = 76/117 (64.96%), Postives = 95/117 (81.20%), Query Frame = 0
BLAST of IVF0012656 vs. ExPASy Swiss-Prot
Match: O22254 (Putative 60S ribosomal protein L18-1 OS=Arabidopsis thaliana OX=3702 GN=RPL18A PE=3 SV=3) HSP 1 Score: 137.9 bits (346), Expect = 7.3e-32 Identity = 71/118 (60.17%), Postives = 90/118 (76.27%), Query Frame = 0
BLAST of IVF0012656 vs. ExPASy Swiss-Prot
Match: Q4PM04 (60S ribosomal protein L18 OS=Ixodes scapularis OX=6945 GN=RpL18 PE=2 SV=1) HSP 1 Score: 136.3 bits (342), Expect = 2.1e-31 Identity = 69/113 (61.06%), Postives = 90/113 (79.65%), Query Frame = 0
BLAST of IVF0012656 vs. ExPASy TrEMBL
Match: A0A5D3BA35 (60S ribosomal protein L18-2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold182G001230 PE=3 SV=1) HSP 1 Score: 230.7 bits (587), Expect = 3.0e-57 Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 0
BLAST of IVF0012656 vs. ExPASy TrEMBL
Match: A0A5A7TD77 (60S ribosomal protein L18-2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold206G00400 PE=3 SV=1) HSP 1 Score: 225.7 bits (574), Expect = 9.8e-56 Identity = 113/115 (98.26%), Postives = 113/115 (98.26%), Query Frame = 0
BLAST of IVF0012656 vs. ExPASy TrEMBL
Match: A0A5A7U942 (60S ribosomal protein L18-2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold16G004150 PE=3 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 4.7e-42 Identity = 92/117 (78.63%), Postives = 102/117 (87.18%), Query Frame = 0
BLAST of IVF0012656 vs. ExPASy TrEMBL
Match: A0A1S3BPL9 (60S ribosomal protein L18-2 OS=Cucumis melo OX=3656 GN=LOC103492145 PE=3 SV=1) HSP 1 Score: 180.3 bits (456), Expect = 4.7e-42 Identity = 92/117 (78.63%), Postives = 102/117 (87.18%), Query Frame = 0
BLAST of IVF0012656 vs. ExPASy TrEMBL
Match: A0A5A7U3L4 (60S ribosomal protein L18-3 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold546G001430 PE=3 SV=1) HSP 1 Score: 178.3 bits (451), Expect = 1.8e-41 Identity = 91/117 (77.78%), Postives = 102/117 (87.18%), Query Frame = 0
BLAST of IVF0012656 vs. NCBI nr
Match: TYJ96153.1 (60S ribosomal protein L18-2 [Cucumis melo var. makuwa]) HSP 1 Score: 229 bits (585), Expect = 7.74e-76 Identity = 115/115 (100.00%), Postives = 115/115 (100.00%), Query Frame = 0
BLAST of IVF0012656 vs. NCBI nr
Match: KAA0041394.1 (60S ribosomal protein L18-2 [Cucumis melo var. makuwa]) HSP 1 Score: 224 bits (572), Expect = 7.45e-74 Identity = 113/115 (98.26%), Postives = 113/115 (98.26%), Query Frame = 0
BLAST of IVF0012656 vs. NCBI nr
Match: XP_008450608.1 (PREDICTED: 60S ribosomal protein L18-2 [Cucumis melo] >KAA0050917.1 60S ribosomal protein L18-2 [Cucumis melo var. makuwa] >TYK10265.1 60S ribosomal protein L18-2 [Cucumis melo var. makuwa]) HSP 1 Score: 179 bits (454), Expect = 7.28e-55 Identity = 92/117 (78.63%), Postives = 102/117 (87.18%), Query Frame = 0
BLAST of IVF0012656 vs. NCBI nr
Match: KAG7030228.1 (60S ribosomal protein L18-2 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 176 bits (447), Expect = 1.57e-54 Identity = 90/117 (76.92%), Postives = 101/117 (86.32%), Query Frame = 0
BLAST of IVF0012656 vs. NCBI nr
Match: XP_011659839.1 (60S ribosomal protein L18-2 [Cucumis sativus] >KAE8653364.1 hypothetical protein Csa_007522 [Cucumis sativus]) HSP 1 Score: 177 bits (449), Expect = 4.19e-54 Identity = 91/116 (78.45%), Postives = 101/116 (87.07%), Query Frame = 0
BLAST of IVF0012656 vs. TAIR 10
Match: AT3G05590.1 (ribosomal protein L18 ) HSP 1 Score: 164.5 bits (415), Expect = 5.2e-41 Identity = 81/117 (69.23%), Postives = 98/117 (83.76%), Query Frame = 0
BLAST of IVF0012656 vs. TAIR 10
Match: AT5G27850.1 (Ribosomal protein L18e/L15 superfamily protein ) HSP 1 Score: 158.7 bits (400), Expect = 2.8e-39 Identity = 78/117 (66.67%), Postives = 97/117 (82.91%), Query Frame = 0
BLAST of IVF0012656 vs. TAIR 10
Match: AT2G47570.1 (Ribosomal protein L18e/L15 superfamily protein ) HSP 1 Score: 137.9 bits (346), Expect = 5.2e-33 Identity = 71/118 (60.17%), Postives = 90/118 (76.27%), Query Frame = 0
BLAST of IVF0012656 vs. TAIR 10
Match: AT2G47570.2 (Ribosomal protein L18e/L15 superfamily protein ) HSP 1 Score: 137.9 bits (346), Expect = 5.2e-33 Identity = 71/118 (60.17%), Postives = 90/118 (76.27%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|