IVF0012596 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGCAAAAGGAAAACCATTTTGTAAAGCTCAAAGAAGTGTACTGGGGTTTTCAGCCATTCTAAAGTATGCAGCTTGCGAATGGTTTCTCATTTTTCTAATGCTTATTGATGCTTTGACTAAATTTGCACATATTTGCAACTTGCAAACGCCATGCATTTTTTGCGGCAGGCTTGATCATCTCTTGGACAAAGAAAAATCTAATAATTATAGGAATCTTCTCTGTACCAATCATAGATTGGAGATATCATCTTTAGTTTCTTGCCACAAACATAATAAAACTTGTTGA ATGGCAGCAAAAGGAAAACCATTTTGTAAAGCTCAAAGAAGTGTACTGGGGTTTTCAGCCATTCTAAAGTATGCAGCTTGCGAATGGTTTCTCATTTTTCTAATGCTTATTGATGCTTTGACTAAATTTGCACATATTTGCAACTTGCAAACGCCATGCATTTTTTGCGGCAGGCTTGATCATCTCTTGGACAAAGAAAAATCTAATAATTATAGGAATCTTCTCTGTACCAATCATAGATTGGAGATATCATCTTTAGTTTCTTGCCACAAACATAATAAAACTTGTTGA ATGGCAGCAAAAGGAAAACCATTTTGTAAAGCTCAAAGAAGTGTACTGGGGTTTTCAGCCATTCTAAAGTATGCAGCTTGCGAATGGTTTCTCATTTTTCTAATGCTTATTGATGCTTTGACTAAATTTGCACATATTTGCAACTTGCAAACGCCATGCATTTTTTGCGGCAGGCTTGATCATCTCTTGGACAAAGAAAAATCTAATAATTATAGGAATCTTCTCTGTACCAATCATAGATTGGAGATATCATCTTTAGTTTCTTGCCACAAACATAATAAAACTTGTTGA MAAKGKPFCKAQRSVLGFSAILKYAACEWFLIFLMLIDALTKFAHICNLQTPCIFCGRLDHLLDKEKSNNYRNLLCTNHRLEISSLVSCHKHNKTC Homology
BLAST of IVF0012596 vs. ExPASy Swiss-Prot
Match: F4INW9 (Probable myosin-binding protein 4 OS=Arabidopsis thaliana OX=3702 GN=MYOB4 PE=3 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 5.2e-15 Identity = 43/86 (50.00%), Postives = 52/86 (60.47%), Query Frame = 0
BLAST of IVF0012596 vs. ExPASy Swiss-Prot
Match: F4HXQ7 (Myosin-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=MYOB1 PE=1 SV=1) HSP 1 Score: 64.7 bits (156), Expect = 6.5e-10 Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 0
BLAST of IVF0012596 vs. ExPASy Swiss-Prot
Match: Q0WNW4 (Myosin-binding protein 3 OS=Arabidopsis thaliana OX=3702 GN=MYOB3 PE=1 SV=1) HSP 1 Score: 59.3 bits (142), Expect = 2.7e-08 Identity = 31/92 (33.70%), Postives = 49/92 (53.26%), Query Frame = 0
BLAST of IVF0012596 vs. ExPASy Swiss-Prot
Match: Q9LMC8 (Probable myosin-binding protein 5 OS=Arabidopsis thaliana OX=3702 GN=MYOB5 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 4.7e-08 Identity = 32/83 (38.55%), Postives = 42/83 (50.60%), Query Frame = 0
BLAST of IVF0012596 vs. ExPASy Swiss-Prot
Match: F4HVS6 (Probable myosin-binding protein 6 OS=Arabidopsis thaliana OX=3702 GN=MYOB6 PE=2 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 3.0e-07 Identity = 28/79 (35.44%), Postives = 42/79 (53.16%), Query Frame = 0
BLAST of IVF0012596 vs. ExPASy TrEMBL
Match: A0A0A0KJF6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G410070 PE=4 SV=1) HSP 1 Score: 182.2 bits (461), Expect = 1.0e-42 Identity = 90/101 (89.11%), Postives = 92/101 (91.09%), Query Frame = 0
BLAST of IVF0012596 vs. ExPASy TrEMBL
Match: A0A6J1CWS2 (probable myosin-binding protein 4 isoform X1 OS=Momordica charantia OX=3673 GN=LOC111015290 PE=4 SV=1) HSP 1 Score: 162.5 bits (410), Expect = 8.5e-37 Identity = 80/99 (80.81%), Postives = 87/99 (87.88%), Query Frame = 0
BLAST of IVF0012596 vs. ExPASy TrEMBL
Match: A0A6J1EYC7 (probable myosin-binding protein 4 OS=Cucurbita moschata OX=3662 GN=LOC111437336 PE=4 SV=1) HSP 1 Score: 155.6 bits (392), Expect = 1.0e-34 Identity = 79/99 (79.80%), Postives = 82/99 (82.83%), Query Frame = 0
BLAST of IVF0012596 vs. ExPASy TrEMBL
Match: A0A1Q3CKY4 (Zein-binding domain-containing protein OS=Cephalotus follicularis OX=3775 GN=CFOL_v3_24369 PE=4 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 3.2e-28 Identity = 65/99 (65.66%), Postives = 74/99 (74.75%), Query Frame = 0
BLAST of IVF0012596 vs. ExPASy TrEMBL
Match: A0A5C7I5E6 (GTD-binding domain-containing protein OS=Acer yangbiense OX=1000413 GN=EZV62_010770 PE=4 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 4.4e-25 Identity = 64/99 (64.65%), Postives = 72/99 (72.73%), Query Frame = 0
BLAST of IVF0012596 vs. NCBI nr
Match: KGN47901.1 (hypothetical protein Csa_002804 [Cucumis sativus]) HSP 1 Score: 180 bits (456), Expect = 1.08e-56 Identity = 90/101 (89.11%), Postives = 92/101 (91.09%), Query Frame = 0
BLAST of IVF0012596 vs. NCBI nr
Match: XP_038888666.1 (probable myosin-binding protein 4 isoform X1 [Benincasa hispida]) HSP 1 Score: 176 bits (447), Expect = 7.35e-49 Identity = 89/99 (89.90%), Postives = 89/99 (89.90%), Query Frame = 0
BLAST of IVF0012596 vs. NCBI nr
Match: XP_022145952.1 (probable myosin-binding protein 4 isoform X1 [Momordica charantia] >XP_022145953.1 probable myosin-binding protein 4 isoform X1 [Momordica charantia] >XP_022145954.1 probable myosin-binding protein 4 isoform X1 [Momordica charantia]) HSP 1 Score: 160 bits (406), Expect = 2.46e-43 Identity = 80/99 (80.81%), Postives = 87/99 (87.88%), Query Frame = 0
BLAST of IVF0012596 vs. NCBI nr
Match: KAG7036331.1 (putative myosin-binding protein 4, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 154 bits (390), Expect = 2.83e-41 Identity = 79/99 (79.80%), Postives = 83/99 (83.84%), Query Frame = 0
BLAST of IVF0012596 vs. NCBI nr
Match: KAG6606393.1 (putative myosin-binding protein 4, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 154 bits (390), Expect = 3.53e-41 Identity = 79/99 (79.80%), Postives = 83/99 (83.84%), Query Frame = 0
BLAST of IVF0012596 vs. TAIR 10
Match: AT2G30690.1 (Protein of unknown function, DUF593 ) HSP 1 Score: 81.6 bits (200), Expect = 3.7e-16 Identity = 43/86 (50.00%), Postives = 52/86 (60.47%), Query Frame = 0
BLAST of IVF0012596 vs. TAIR 10
Match: AT1G08800.1 (Protein of unknown function, DUF593 ) HSP 1 Score: 64.7 bits (156), Expect = 4.6e-11 Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 0
BLAST of IVF0012596 vs. TAIR 10
Match: AT1G08800.2 (Protein of unknown function, DUF593 ) HSP 1 Score: 64.7 bits (156), Expect = 4.6e-11 Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 0
BLAST of IVF0012596 vs. TAIR 10
Match: AT5G16720.1 (Protein of unknown function, DUF593 ) HSP 1 Score: 59.3 bits (142), Expect = 2.0e-09 Identity = 31/92 (33.70%), Postives = 49/92 (53.26%), Query Frame = 0
BLAST of IVF0012596 vs. TAIR 10
Match: AT1G18990.1 (Protein of unknown function, DUF593 ) HSP 1 Score: 58.5 bits (140), Expect = 3.3e-09 Identity = 32/83 (38.55%), Postives = 42/83 (50.60%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|