IVF0011262 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGGACGACTTTCAAGTTATTGATCGGAGTACATATGCCCTGCTGATCCAAGCACTATGTTCAGCAAACATGATTTCGGAGGCACTTGCAAATTTGCATCATATGATTGAAAAAGGCTACCCTCCAACACCGATTATCATTGACGTTATTGTTCAAACACTTTGTCACAGGGGAAGCATCGACGAAACATCGTGTGTTTTGGGGCATGGAATCCCTTTCACAACGATTTCTTTTGACTTGTTAATGCATGAGCTTAATACACAGGGAATGTATATCAGTGCTTGA ATGAAGGACGACTTTCAAGTTATTGATCGGAGTACATATGCCCTGCTGATCCAAGCACTATGTTCAGCAAACATGATTTCGGAGGCACTTGCAAATTTGCATCATATGATTGAAAAAGGCTACCCTCCAACACCGATTATCATTGACGTTATTGTTCAAACACTTTGTCACAGGGGAAGCATCGACGAAACATCGTGTGTTTTGGGGCATGGAATCCCTTTCACAACGATTTCTTTTGACTTGTTAATGCATGAGCTTAATACACAGGGAATGTATATCAGTGCTTGA ATGAAGGACGACTTTCAAGTTATTGATCGGAGTACATATGCCCTGCTGATCCAAGCACTATGTTCAGCAAACATGATTTCGGAGGCACTTGCAAATTTGCATCATATGATTGAAAAAGGCTACCCTCCAACACCGATTATCATTGACGTTATTGTTCAAACACTTTGTCACAGGGGAAGCATCGACGAAACATCGTGTGTTTTGGGGCATGGAATCCCTTTCACAACGATTTCTTTTGACTTGTTAATGCATGAGCTTAATACACAGGGAATGTATATCAGTGCTTGA MKDDFQVIDRSTYALLIQALCSANMISEALANLHHMIEKGYPPTPIIIDVIVQTLCHRGSIDETSCVLGHGIPFTTISFDLLMHELNTQGMYISA Homology
BLAST of IVF0011262 vs. ExPASy Swiss-Prot
Match: O49436 (Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana OX=3702 GN=EMB1025 PE=3 SV=1) HSP 1 Score: 47.4 bits (111), Expect = 1.1e-04 Identity = 24/86 (27.91%), Postives = 44/86 (51.16%), Query Frame = 0
BLAST of IVF0011262 vs. ExPASy Swiss-Prot
Match: Q9SHK2 (Pentatricopeptide repeat-containing protein At1g06580 OS=Arabidopsis thaliana OX=3702 GN=At1g06580 PE=2 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 5.3e-04 Identity = 22/85 (25.88%), Postives = 42/85 (49.41%), Query Frame = 0
BLAST of IVF0011262 vs. ExPASy Swiss-Prot
Match: Q9ASZ8 (Pentatricopeptide repeat-containing protein At1g12620 OS=Arabidopsis thaliana OX=3702 GN=At1g12620 PE=2 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 5.3e-04 Identity = 20/55 (36.36%), Postives = 31/55 (56.36%), Query Frame = 0
BLAST of IVF0011262 vs. ExPASy Swiss-Prot
Match: Q9CAN5 (Pentatricopeptide repeat-containing protein At1g63080, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g63080 PE=2 SV=1) HSP 1 Score: 45.1 bits (105), Expect = 5.3e-04 Identity = 24/79 (30.38%), Postives = 41/79 (51.90%), Query Frame = 0
BLAST of IVF0011262 vs. ExPASy TrEMBL
Match: A0A5D3DMQ7 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold352G00200 PE=4 SV=1) HSP 1 Score: 196.8 bits (499), Expect = 4.0e-47 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 0
BLAST of IVF0011262 vs. ExPASy TrEMBL
Match: A0A5A7TQU3 (Pentatricopeptide repeat-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold236G005880 PE=4 SV=1) HSP 1 Score: 194.1 bits (492), Expect = 2.6e-46 Identity = 94/95 (98.95%), Postives = 94/95 (98.95%), Query Frame = 0
BLAST of IVF0011262 vs. ExPASy TrEMBL
Match: A0A6J1J506 (pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like OS=Cucurbita maxima OX=3661 GN=LOC111481420 PE=4 SV=1) HSP 1 Score: 139.8 bits (351), Expect = 5.8e-30 Identity = 67/95 (70.53%), Postives = 76/95 (80.00%), Query Frame = 0
BLAST of IVF0011262 vs. ExPASy TrEMBL
Match: A0A6J1F9P1 (pentatricopeptide repeat-containing protein At1g09900-like OS=Cucurbita moschata OX=3662 GN=LOC111442091 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.4e-28 Identity = 65/95 (68.42%), Postives = 73/95 (76.84%), Query Frame = 0
BLAST of IVF0011262 vs. ExPASy TrEMBL
Match: A0A6J1DW66 (pentatricopeptide repeat-containing protein At1g09900-like OS=Momordica charantia OX=3673 GN=LOC111024057 PE=4 SV=1) HSP 1 Score: 115.2 bits (287), Expect = 1.5e-22 Identity = 57/104 (54.81%), Postives = 73/104 (70.19%), Query Frame = 0
BLAST of IVF0011262 vs. NCBI nr
Match: TYK24907.1 (pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 198 bits (503), Expect = 1.46e-63 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 0
BLAST of IVF0011262 vs. NCBI nr
Match: KAA0044227.1 (pentatricopeptide repeat-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 195 bits (496), Expect = 1.70e-62 Identity = 94/95 (98.95%), Postives = 94/95 (98.95%), Query Frame = 0
BLAST of IVF0011262 vs. NCBI nr
Match: XP_038904608.1 (pentatricopeptide repeat-containing protein At1g09900-like [Benincasa hispida]) HSP 1 Score: 152 bits (385), Expect = 9.64e-42 Identity = 73/95 (76.84%), Postives = 79/95 (83.16%), Query Frame = 0
BLAST of IVF0011262 vs. NCBI nr
Match: XP_022982589.1 (pentatricopeptide repeat-containing protein At5g64320, mitochondrial-like [Cucurbita maxima]) HSP 1 Score: 141 bits (355), Expect = 2.39e-37 Identity = 67/95 (70.53%), Postives = 76/95 (80.00%), Query Frame = 0
BLAST of IVF0011262 vs. NCBI nr
Match: KAG6580429.1 (Pentatricopeptide repeat-containing protein, mitochondrial, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 137 bits (344), Expect = 9.23e-36 Identity = 65/95 (68.42%), Postives = 73/95 (76.84%), Query Frame = 0
BLAST of IVF0011262 vs. TAIR 10
Match: AT1G77340.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 50.1 bits (118), Expect = 1.2e-06 Identity = 26/70 (37.14%), Postives = 37/70 (52.86%), Query Frame = 0
BLAST of IVF0011262 vs. TAIR 10
Match: AT4G20090.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 47.4 bits (111), Expect = 7.6e-06 Identity = 24/86 (27.91%), Postives = 44/86 (51.16%), Query Frame = 0
BLAST of IVF0011262 vs. TAIR 10
Match: AT1G12620.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 45.1 bits (105), Expect = 3.8e-05 Identity = 20/55 (36.36%), Postives = 31/55 (56.36%), Query Frame = 0
BLAST of IVF0011262 vs. TAIR 10
Match: AT1G06580.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 45.1 bits (105), Expect = 3.8e-05 Identity = 22/85 (25.88%), Postives = 42/85 (49.41%), Query Frame = 0
BLAST of IVF0011262 vs. TAIR 10
Match: AT1G63080.1 (Pentatricopeptide repeat (PPR) superfamily protein ) HSP 1 Score: 45.1 bits (105), Expect = 3.8e-05 Identity = 24/79 (30.38%), Postives = 41/79 (51.90%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|