IVF0010879 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGTGGCTTCTTATGTCGGTTTTGATGGATCATCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCACTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGGTTGAGGTTTGA ATGGTTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGTGGCTTCTTATGTCGGTTTTGATGGATCATCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCACTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGGTTGAGGTTTGA ATGGTTGCGATGGTGAGGGCGAGCTCCGGCTTGCAATATCCCGATCGGTTCTACGCCGTGGCTTCTTATGTCGGTTTTGATGGATCATCGAAATTGTCTTCAAAGGCCCTCAGGTCTAAGTTCTCTGATGAGGCCACTTTGTTACTCTATGGCTTGTATCAGCAGGTACTACCACGTGTTCTTACACCTGTGACTTACCGGTGCTGTTTCAGTTTGGTTGAGGTTTGA MVAMVRASSGLQYPDRFYAVASYVGFDGSSKLSSKALRSKFSDEATLLLYGLYQQVLPRVLTPVTYRCCFSLVEV Homology
BLAST of IVF0010879 vs. ExPASy Swiss-Prot
Match: Q8RWD9 (Acyl-CoA-binding domain-containing protein 5 OS=Arabidopsis thaliana OX=3702 GN=ACBP5 PE=1 SV=1) HSP 1 Score: 69.7 bits (169), Expect = 1.6e-11 Identity = 37/55 (67.27%), Postives = 42/55 (76.36%), Query Frame = 0
BLAST of IVF0010879 vs. ExPASy Swiss-Prot
Match: Q9MA55 (Acyl-CoA-binding domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=ACBP4 PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 3.9e-10 Identity = 34/54 (62.96%), Postives = 40/54 (74.07%), Query Frame = 0
BLAST of IVF0010879 vs. ExPASy Swiss-Prot
Match: Q75LJ4 (Acyl-CoA-binding domain-containing protein 6 OS=Oryza sativa subsp. japonica OX=39947 GN=ACBP6 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 9.6e-09 Identity = 34/66 (51.52%), Postives = 39/66 (59.09%), Query Frame = 0
BLAST of IVF0010879 vs. ExPASy TrEMBL
Match: A0A5D3E5D6 (Acyl-CoA-binding domain-containing protein 4 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold30706G00010 PE=4 SV=1) HSP 1 Score: 147.9 bits (372), Expect = 1.7e-32 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 0
BLAST of IVF0010879 vs. ExPASy TrEMBL
Match: A0A5A7TGN5 (O-fucosyltransferase family protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold795G001170 PE=3 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 3.8e-32 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0010879 vs. ExPASy TrEMBL
Match: A0A5D3CJT5 (Acyl-CoA-binding domain-containing protein 4 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold828G00570 PE=4 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 1.3e-29 Identity = 69/74 (93.24%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of IVF0010879 vs. ExPASy TrEMBL
Match: A0A5D3C6F7 (Acyl-CoA-binding domain-containing protein 4 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold202G002100 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 3.9e-29 Identity = 68/74 (91.89%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of IVF0010879 vs. ExPASy TrEMBL
Match: A0A5A7VFV5 (Acyl-CoA-binding domain-containing protein 4 isoform X2 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold979G00450 PE=4 SV=1) HSP 1 Score: 136.7 bits (343), Expect = 3.9e-29 Identity = 68/74 (91.89%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of IVF0010879 vs. NCBI nr
Match: TYK30810.1 (acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 149 bits (377), Expect = 2.33e-45 Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 0
BLAST of IVF0010879 vs. NCBI nr
Match: KAA0042393.1 (uncharacterized protein E6C27_scaffold795G001170 [Cucumis melo var. makuwa]) HSP 1 Score: 148 bits (374), Expect = 3.20e-43 Identity = 74/74 (100.00%), Postives = 74/74 (100.00%), Query Frame = 0
BLAST of IVF0010879 vs. NCBI nr
Match: KAA0063418.1 (acyl-CoA-binding domain-containing protein 4 [Cucumis melo var. makuwa] >TYK11680.1 acyl-CoA-binding domain-containing protein 4 [Cucumis melo var. makuwa]) HSP 1 Score: 140 bits (352), Expect = 9.26e-41 Identity = 69/74 (93.24%), Postives = 69/74 (93.24%), Query Frame = 0
BLAST of IVF0010879 vs. NCBI nr
Match: KAA0025187.1 (acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa] >TYK07477.1 acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 138 bits (348), Expect = 1.15e-40 Identity = 68/74 (91.89%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of IVF0010879 vs. NCBI nr
Match: KAA0031885.1 (acyl-CoA-binding domain-containing protein 4 isoform X2 [Cucumis melo var. makuwa]) HSP 1 Score: 138 bits (348), Expect = 2.61e-40 Identity = 68/74 (91.89%), Postives = 68/74 (91.89%), Query Frame = 0
BLAST of IVF0010879 vs. TAIR 10
Match: AT5G27630.1 (acyl-CoA binding protein 5 ) HSP 1 Score: 69.7 bits (169), Expect = 1.1e-12 Identity = 37/55 (67.27%), Postives = 42/55 (76.36%), Query Frame = 0
BLAST of IVF0010879 vs. TAIR 10
Match: AT3G05420.1 (acyl-CoA binding protein 4 ) HSP 1 Score: 65.1 bits (157), Expect = 2.8e-11 Identity = 34/54 (62.96%), Postives = 40/54 (74.07%), Query Frame = 0
BLAST of IVF0010879 vs. TAIR 10
Match: AT3G05420.2 (acyl-CoA binding protein 4 ) HSP 1 Score: 65.1 bits (157), Expect = 2.8e-11 Identity = 34/54 (62.96%), Postives = 40/54 (74.07%), Query Frame = 0
The following BLAST results are available for this feature:
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|