IVF0010779 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCCTCAGGCACGACCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAAAGCAGCAGATGTTGTAGCGAAACGTATTGCAAAAGAGGGGAAATTGGCCACATTCAGATTACCGTCTAGGGAGGTCTGTTTGATATCCAAAAGTTGCTCCGTAATAGTTGGGCAAATGGAGAATGTTGGGGTCAACCAGAAAAGTTTCGAAAGAGCCGAATCTCAATGTTGGCTAGGTAAGCATCCTGTAGTAAGGGGAGTAGTTATGAACCCTGTAGACCATCCCCATAAGGGTGGTGAAGGGAGGGCCCAAATTGGTAGAAAAAACCCGCAACCCCTTAGGGTTATCCTGCACTTGGAAGAAGTAGAAAAAGGAATCAATATAGTGAGAATTTGA ATGCCCTCAGGCACGACCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAAAGCAGCAGATGTTGTAGCGAAACGTATTGCAAAAGAGGGGAAATTGGCCACATTCAGATTACCGTCTAGGGAGGTCTGTTTGATATCCAAAAGTTGCTCCGTAATAGTTGGGCAAATGGAGAATGTTGGGGTCAACCAGAAAAGTTTCGAAAGAGCCGAATCTCAATGTTGGCTAGGTAAGCATCCTGTAGTAAGGGGAGTAGTTATGAACCCTGTAGACCATCCCCATAAGGGTGGTGAAGGGAGGGCCCAAATTGGTAGAAAAAACCCGCAACCCCTTAGGGTTATCCTGCACTTGGAAGAAGTAGAAAAAGGAATCAATATAGTGAGAATTTGA ATGCCCTCAGGCACGACCATACATAACATAGAAATCACACTTGGGAAGGGGGGACAATTAGCTAAAGCAGCAGATGTTGTAGCGAAACGTATTGCAAAAGAGGGGAAATTGGCCACATTCAGATTACCGTCTAGGGAGGTCTGTTTGATATCCAAAAGTTGCTCCGTAATAGTTGGGCAAATGGAGAATGTTGGGGTCAACCAGAAAAGTTTCGAAAGAGCCGAATCTCAATGTTGGCTAGGTAAGCATCCTGTAGTAAGGGGAGTAGTTATGAACCCTGTAGACCATCCCCATAAGGGTGGTGAAGGGAGGGCCCAAATTGGTAGAAAAAACCCGCAACCCCTTAGGGTTATCCTGCACTTGGAAGAAGTAGAAAAAGGAATCAATATAGTGAGAATTTGA MPSGTTIHNIEITLGKGGQLAKAADVVAKRIAKEGKLATFRLPSREVCLISKSCSVIVGQMENVGVNQKSFERAESQCWLGKHPVVRGVVMNPVDHPHKGGEGRAQIGRKNPQPLRVILHLEEVEKGINIVRI Homology
BLAST of IVF0010779 vs. ExPASy Swiss-Prot
Match: P21434 (50S ribosomal protein L2, chloroplastic OS=Nicotiana debneyi OX=4089 GN=rpl2 PE=3 SV=1) HSP 1 Score: 180.6 bits (457), Expect = 1.1e-44 Identity = 98/134 (73.13%), Postives = 105/134 (78.36%), Query Frame = 0
BLAST of IVF0010779 vs. ExPASy Swiss-Prot
Match: Q0G9F5 (50S ribosomal protein L2-A, chloroplastic OS=Liriodendron tulipifera OX=3415 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 9.6e-44 Identity = 89/112 (79.46%), Postives = 93/112 (83.04%), Query Frame = 0
BLAST of IVF0010779 vs. ExPASy Swiss-Prot
Match: Q0G9H8 (50S ribosomal protein L2-B, chloroplastic OS=Liriodendron tulipifera OX=3415 GN=rpl2-B PE=3 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 9.6e-44 Identity = 89/112 (79.46%), Postives = 93/112 (83.04%), Query Frame = 0
BLAST of IVF0010779 vs. ExPASy Swiss-Prot
Match: A1XFZ7 (50S ribosomal protein L2, chloroplastic OS=Nuphar advena OX=77108 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 9.6e-44 Identity = 89/112 (79.46%), Postives = 93/112 (83.04%), Query Frame = 0
BLAST of IVF0010779 vs. ExPASy Swiss-Prot
Match: Q09FY3 (50S ribosomal protein L2, chloroplastic OS=Platanus occidentalis OX=4403 GN=rpl2-A PE=3 SV=1) HSP 1 Score: 176.8 bits (447), Expect = 1.6e-43 Identity = 88/112 (78.57%), Postives = 93/112 (83.04%), Query Frame = 0
BLAST of IVF0010779 vs. ExPASy TrEMBL
Match: A0A5A7SM35 (Ribosomal protein L2 (Chloroplast) OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold194G001190 PE=4 SV=1) HSP 1 Score: 217.6 bits (553), Expect = 3.1e-53 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 0
BLAST of IVF0010779 vs. ExPASy TrEMBL
Match: A0A4D6IUD4 (Ribosomal protein L2 OS=Tinospora cordifolia OX=285590 GN=rpl2 PE=3 SV=1) HSP 1 Score: 204.5 bits (519), Expect = 2.7e-49 Identity = 106/132 (80.30%), Postives = 111/132 (84.09%), Query Frame = 0
BLAST of IVF0010779 vs. ExPASy TrEMBL
Match: A0A650F363 (Ribosomal protein L2 OS=Vachellia nilotica OX=138033 GN=rpl2 PE=3 SV=1) HSP 1 Score: 198.7 bits (504), Expect = 1.5e-47 Identity = 105/134 (78.36%), Postives = 110/134 (82.09%), Query Frame = 0
BLAST of IVF0010779 vs. ExPASy TrEMBL
Match: A0A7T8IMF6 (Ribosomal protein L2 OS=Prunus persica OX=3760 GN=rpl2 PE=4 SV=1) HSP 1 Score: 198.0 bits (502), Expect = 2.5e-47 Identity = 103/134 (76.87%), Postives = 110/134 (82.09%), Query Frame = 0
BLAST of IVF0010779 vs. ExPASy TrEMBL
Match: A0A6G5NV90 (50S ribosomal protein L2 OS=Camellia mingii OX=2547915 GN=rpl2 PE=3 SV=1) HSP 1 Score: 197.6 bits (501), Expect = 3.3e-47 Identity = 105/134 (78.36%), Postives = 110/134 (82.09%), Query Frame = 0
BLAST of IVF0010779 vs. NCBI nr
Match: KAA0031820.1 (ribosomal protein L2 [Cucumis melo var. makuwa] >TYJ97314.1 ribosomal protein L2 [Cucumis melo var. makuwa]) HSP 1 Score: 218 bits (554), Expect = 6.90e-71 Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 0
BLAST of IVF0010779 vs. NCBI nr
Match: QHO02027.1 (50S ribosomal protein [Arachis hypogaea] >QHO07411.1 50S ribosomal protein [Arachis hypogaea]) HSP 1 Score: 203 bits (516), Expect = 9.97e-65 Identity = 105/132 (79.55%), Postives = 111/132 (84.09%), Query Frame = 0
BLAST of IVF0010779 vs. NCBI nr
Match: YP_009627433.1 (ribosomal protein L2 [Tinospora cordifolia] >QCC70833.1 ribosomal protein L2 [Tinospora cordifolia]) HSP 1 Score: 205 bits (521), Expect = 1.58e-63 Identity = 106/132 (80.30%), Postives = 111/132 (84.09%), Query Frame = 0
BLAST of IVF0010779 vs. NCBI nr
Match: KAD7116973.1 (hypothetical protein E3N88_04241 [Mikania micrantha]) HSP 1 Score: 196 bits (497), Expect = 7.83e-62 Identity = 102/132 (77.27%), Postives = 109/132 (82.58%), Query Frame = 0
BLAST of IVF0010779 vs. NCBI nr
Match: KAG4914348.1 (hypothetical protein JHK87_051905 [Glycine soja]) HSP 1 Score: 199 bits (505), Expect = 1.97e-61 Identity = 103/132 (78.03%), Postives = 109/132 (82.58%), Query Frame = 0
BLAST of IVF0010779 vs. TAIR 10
Match: ATCG00830.1 (ribosomal protein L2 ) HSP 1 Score: 175.3 bits (443), Expect = 3.4e-44 Identity = 87/112 (77.68%), Postives = 93/112 (83.04%), Query Frame = 0
BLAST of IVF0010779 vs. TAIR 10
Match: ATCG01310.1 (ribosomal protein L2 ) HSP 1 Score: 175.3 bits (443), Expect = 3.4e-44 Identity = 87/112 (77.68%), Postives = 93/112 (83.04%), Query Frame = 0
BLAST of IVF0010779 vs. TAIR 10
Match: AT2G44065.1 (Ribosomal protein L2 family ) HSP 1 Score: 84.0 bits (206), Expect = 1.0e-16 Identity = 43/107 (40.19%), Postives = 59/107 (55.14%), Query Frame = 0
BLAST of IVF0010779 vs. TAIR 10
Match: AT2G44065.2 (Ribosomal protein L2 family ) HSP 1 Score: 84.0 bits (206), Expect = 1.0e-16 Identity = 43/107 (40.19%), Postives = 59/107 (55.14%), Query Frame = 0
BLAST of IVF0010779 vs. TAIR 10
Match: AT3G51190.1 (Ribosomal protein L2 family ) HSP 1 Score: 67.4 bits (163), Expect = 9.9e-12 Identity = 40/112 (35.71%), Postives = 57/112 (50.89%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|