IVF0010373 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCGTTTTGGGAATTTTCGAATTCTTGTGCTTGCTTATGCTGGAATGGAATGGGTGTTAGAAGCTATGGAATTGATGTTGATCTCCTTTGTTGGACTTGGAGTCCAGTCTGCATGGAACCTTTCTCCCCATGAAGAGTCTTTGATCACCCGTGTGGTTTTTGCAAGTATGTTAGTTGGGGCCTATACATGGGGCATAGTCTCCGATAAATATGGACCGTCCCCGTTGAAGGATCGGAGGAGTCACTGA ATGCGTTTTGGGAATTTTCGAATTCTTGTGCTTGCTTATGCTGGAATGGAATGGGTGTTAGAAGCTATGGAATTGATGTTGATCTCCTTTGTTGGACTTGGAGTCCAGTCTGCATGGAACCTTTCTCCCCATGAAGAGTCTTTGATCACCCGTGTGGTTTTTGCAAGTATGTTAGTTGGGGCCTATACATGGGGCATAGTCTCCGATAAATATGGACCGTCCCCGTTGAAGGATCGGAGGAGTCACTGA ATGCGTTTTGGGAATTTTCGAATTCTTGTGCTTGCTTATGCTGGAATGGAATGGGTGTTAGAAGCTATGGAATTGATGTTGATCTCCTTTGTTGGACTTGGAGTCCAGTCTGCATGGAACCTTTCTCCCCATGAAGAGTCTTTGATCACCCGTGTGGTTTTTGCAAGTATGTTAGTTGGGGCCTATACATGGGGCATAGTCTCCGATAAATATGGACCGTCCCCGTTGAAGGATCGGAGGAGTCACTGA MRFGNFRILVLAYAGMEWVLEAMELMLISFVGLGVQSAWNLSPHEESLITRVVFASMLVGAYTWGIVSDKYGPSPLKDRRSH Homology
BLAST of IVF0010373 vs. ExPASy Swiss-Prot
Match: Q940M4 (Organic cation/carnitine transporter 7 OS=Arabidopsis thaliana OX=3702 GN=OCT7 PE=2 SV=1) HSP 1 Score: 110.5 bits (275), Expect = 8.9e-24 Identity = 53/72 (73.61%), Postives = 60/72 (83.33%), Query Frame = 0
BLAST of IVF0010373 vs. ExPASy Swiss-Prot
Match: P30638 (Putative transporter svop-1 OS=Caenorhabditis elegans OX=6239 GN=svop-1 PE=3 SV=5) HSP 1 Score: 60.5 bits (145), Expect = 1.1e-08 Identity = 23/70 (32.86%), Postives = 44/70 (62.86%), Query Frame = 0
BLAST of IVF0010373 vs. ExPASy Swiss-Prot
Match: Q2XWK0 (Synaptic vesicle 2-related protein OS=Xenopus laevis OX=8355 GN=svop PE=2 SV=1) HSP 1 Score: 57.4 bits (137), Expect = 8.9e-08 Identity = 25/70 (35.71%), Postives = 41/70 (58.57%), Query Frame = 0
BLAST of IVF0010373 vs. ExPASy Swiss-Prot
Match: Q1JP63 (Synaptic vesicle 2-related protein OS=Bos taurus OX=9913 GN=SVOP PE=2 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.2e-07 Identity = 24/70 (34.29%), Postives = 41/70 (58.57%), Query Frame = 0
BLAST of IVF0010373 vs. ExPASy Swiss-Prot
Match: Q8N4V2 (Synaptic vesicle 2-related protein OS=Homo sapiens OX=9606 GN=SVOP PE=1 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.2e-07 Identity = 24/70 (34.29%), Postives = 41/70 (58.57%), Query Frame = 0
BLAST of IVF0010373 vs. ExPASy TrEMBL
Match: A0A5D3E221 (Organic cation/carnitine transporter 7 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold208G00570 PE=4 SV=1) HSP 1 Score: 169.1 bits (427), Expect = 7.8e-39 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of IVF0010373 vs. ExPASy TrEMBL
Match: A0A5A7SWS5 (Organic cation/carnitine transporter 7 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold403G00690 PE=4 SV=1) HSP 1 Score: 167.9 bits (424), Expect = 1.7e-38 Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of IVF0010373 vs. ExPASy TrEMBL
Match: A0A5A7T162 (Organic cation/carnitine transporter 7 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold832G00440 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 3.4e-26 Identity = 61/72 (84.72%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of IVF0010373 vs. ExPASy TrEMBL
Match: A0A1S3C3X5 (organic cation/carnitine transporter 7 OS=Cucumis melo OX=3656 GN=LOC103496199 PE=4 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 3.4e-26 Identity = 61/72 (84.72%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of IVF0010373 vs. ExPASy TrEMBL
Match: A0A0A0L6X7 (MFS domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G198470 PE=4 SV=1) HSP 1 Score: 124.4 bits (311), Expect = 2.2e-25 Identity = 60/72 (83.33%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of IVF0010373 vs. NCBI nr
Match: TYK29828.1 (organic cation/carnitine transporter 7 [Cucumis melo var. makuwa]) HSP 1 Score: 167 bits (423), Expect = 3.65e-52 Identity = 82/82 (100.00%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of IVF0010373 vs. NCBI nr
Match: KAA0035784.1 (organic cation/carnitine transporter 7 [Cucumis melo var. makuwa]) HSP 1 Score: 166 bits (420), Expect = 1.05e-51 Identity = 81/82 (98.78%), Postives = 82/82 (100.00%), Query Frame = 0
BLAST of IVF0010373 vs. NCBI nr
Match: XP_008456184.1 (PREDICTED: organic cation/carnitine transporter 7 [Cucumis melo] >KAA0037214.1 organic cation/carnitine transporter 7 [Cucumis melo var. makuwa] >TYK13859.1 organic cation/carnitine transporter 7 [Cucumis melo var. makuwa]) HSP 1 Score: 126 bits (316), Expect = 6.23e-32 Identity = 61/72 (84.72%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of IVF0010373 vs. NCBI nr
Match: XP_004140724.1 (organic cation/carnitine transporter 7 isoform X1 [Cucumis sativus]) HSP 1 Score: 123 bits (309), Expect = 6.17e-31 Identity = 60/72 (83.33%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of IVF0010373 vs. NCBI nr
Match: XP_038894162.1 (organic cation/carnitine transporter 7 isoform X1 [Benincasa hispida]) HSP 1 Score: 123 bits (308), Expect = 8.78e-31 Identity = 60/72 (83.33%), Postives = 65/72 (90.28%), Query Frame = 0
BLAST of IVF0010373 vs. TAIR 10
Match: AT3G13050.1 (Major facilitator superfamily protein ) HSP 1 Score: 110.5 bits (275), Expect = 6.3e-25 Identity = 53/72 (73.61%), Postives = 60/72 (83.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|