
IVF0009136 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonfive_prime_UTRCDSpolypeptidethree_prime_UTR Hold the cursor over a type above to highlight its positions in the sequence below.AAAAAATGGGATCCCAGCCCAAAATGAGCATCAGCATCCCTTCCACCGCCAAAAGCGCCGGCGATGGGGACGGCGTGGCGGGGCACTCATGTTCATCCAAAGCTCAATGCCTCTGTTCCCCCACCACTCATCCTGGTTCCTTCCGGTGTCGGCTTCACCGTTCCAATTCGTTGCCATGGAGTAGGCAGTCCAAATCCACCGCTGCATCCGCCGACGCCTCTAACACCTCAGATCTCTCTCCAAAGTCAGTTGAATCTGCTTGATTTTTCAATTACTATCTATCGGCCAAAACAACAAATAATGAAACCCTCTGTAAATATTTATATATATGTATTCCTCTCTCTCTCTCTCTCTGTTCTCACTCCACTCTTAAAATTTATTAAAAATCCATGCGTGTGTTTTTGTTTCTATTGCGAT AAAAAATGGGATCCCAGCCCAAAATGAGCATCAGCATCCCTTCCACCGCCAAAAGCGCCGGCGATGGGGACGGCGTGGCGGGGCACTCATGTTCATCCAAAGCTCAATGCCTCTGTTCCCCCACCACTCATCCTGGTTCCTTCCGGTGTCGGCTTCACCGTTCCAATTCGTTGCCATGGAGTAGGCAGTCCAAATCCACCGCTGCATCCGCCGACGCCTCTAACACCTCAGATCTCTCTCCAAAGTCAGTTGAATCTGCTTGATTTTTCAATTACTATCTATCGGCCAAAACAACAAATAATGAAACCCTCTGTAAATATTTATATATATGTATTCCTCTCTCTCTCTCTCTCTGTTCTCACTCCACTCTTAAAATTTATTAAAAATCCATGCGTGTGTTTTTGTTTCTATTGCGAT ATGGGATCCCAGCCCAAAATGAGCATCAGCATCCCTTCCACCGCCAAAAGCGCCGGCGATGGGGACGGCGTGGCGGGGCACTCATGTTCATCCAAAGCTCAATGCCTCTGTTCCCCCACCACTCATCCTGGTTCCTTCCGGTGTCGGCTTCACCGTTCCAATTCGTTGCCATGGAGTAGGCAGTCCAAATCCACCGCTGCATCCGCCGACGCCTCTAACACCTCAGATCTCTCTCCAAAGTCAGTTGAATCTGCTTGA MGSQPKMSISIPSTAKSAGDGDGVAGHSCSSKAQCLCSPTTHPGSFRCRLHRSNSLPWSRQSKSTAASADASNTSDLSPKSVESA Homology
BLAST of IVF0009136 vs. ExPASy TrEMBL
Match: A0A5D3BJV5 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold596G00570 PE=4 SV=1) HSP 1 Score: 164.5 bits (415), Expect = 2.0e-37 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of IVF0009136 vs. ExPASy TrEMBL
Match: A0A0A0LWJ0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_1G369490 PE=4 SV=1) HSP 1 Score: 149.4 bits (376), Expect = 6.6e-33 Identity = 80/87 (91.95%), Postives = 81/87 (93.10%), Query Frame = 0
BLAST of IVF0009136 vs. ExPASy TrEMBL
Match: A0A6A1UK22 (Uncharacterized protein OS=Morella rubra OX=262757 GN=CJ030_MR0G006893 PE=4 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 7.8e-10 Identity = 46/77 (59.74%), Postives = 56/77 (72.73%), Query Frame = 0
BLAST of IVF0009136 vs. ExPASy TrEMBL
Match: A0A5N6QHE2 (Uncharacterized protein OS=Carpinus fangiana OX=176857 GN=FH972_003263 PE=4 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 3.0e-09 Identity = 39/72 (54.17%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of IVF0009136 vs. ExPASy TrEMBL
Match: A0A7J7GYA4 (Uncharacterized protein OS=Camellia sinensis OX=4442 GN=HYC85_015991 PE=4 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 5.1e-09 Identity = 40/79 (50.63%), Postives = 51/79 (64.56%), Query Frame = 0
BLAST of IVF0009136 vs. NCBI nr
Match: KAA0046595.1 (hypothetical protein E6C27_scaffold114G001360 [Cucumis melo var. makuwa] >TYK00101.1 hypothetical protein E5676_scaffold596G00570 [Cucumis melo var. makuwa]) HSP 1 Score: 164 bits (416), Expect = 5.30e-51 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of IVF0009136 vs. NCBI nr
Match: KAE8653119.1 (hypothetical protein Csa_020123 [Cucumis sativus]) HSP 1 Score: 143 bits (360), Expect = 5.70e-42 Identity = 76/82 (92.68%), Postives = 77/82 (93.90%), Query Frame = 0
BLAST of IVF0009136 vs. NCBI nr
Match: KAG6589904.1 (hypothetical protein SDJN03_15327, partial [Cucurbita argyrosperma subsp. sororia] >KAG7023574.1 hypothetical protein SDJN02_14600, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 131 bits (329), Expect = 1.02e-37 Identity = 68/85 (80.00%), Postives = 76/85 (89.41%), Query Frame = 0
BLAST of IVF0009136 vs. NCBI nr
Match: KAB1200592.1 (hypothetical protein CJ030_MR0G006893 [Morella rubra]) HSP 1 Score: 74.3 bits (181), Expect = 2.96e-15 Identity = 46/76 (60.53%), Postives = 55/76 (72.37%), Query Frame = 0
BLAST of IVF0009136 vs. NCBI nr
Match: KAE7998752.1 (hypothetical protein FH972_003263 [Carpinus fangiana]) HSP 1 Score: 71.6 bits (174), Expect = 3.52e-14 Identity = 39/72 (54.17%), Postives = 49/72 (68.06%), Query Frame = 0
BLAST of IVF0009136 vs. TAIR 10
Match: AT3G13227.1 (serine-rich protein-related ) HSP 1 Score: 50.4 bits (119), Expect = 8.0e-07 Identity = 25/46 (54.35%), Postives = 29/46 (63.04%), Query Frame = 0
BLAST of IVF0009136 vs. TAIR 10
Match: AT1G67910.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 12 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G24577.1); Has 167 Blast hits to 167 proteins in 19 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 167; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 49.7 bits (117), Expect = 1.4e-06 Identity = 33/80 (41.25%), Postives = 46/80 (57.50%), Query Frame = 0
BLAST of IVF0009136 vs. TAIR 10
Match: AT1G67910.2 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 12 growth stages; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G24577.1). ) HSP 1 Score: 49.7 bits (117), Expect = 1.4e-06 Identity = 33/80 (41.25%), Postives = 46/80 (57.50%), Query Frame = 0
BLAST of IVF0009136 vs. TAIR 10
Match: AT1G24577.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G67910.2); Has 115 Blast hits to 115 proteins in 17 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 115; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 47.0 bits (110), Expect = 8.9e-06 Identity = 19/34 (55.88%), Postives = 27/34 (79.41%), Query Frame = 0
BLAST of IVF0009136 vs. TAIR 10
Match: AT5G25280.1 (serine-rich protein-related ) HSP 1 Score: 43.9 bits (102), Expect = 7.5e-05 Identity = 18/34 (52.94%), Postives = 26/34 (76.47%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
|