IVF0008072 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTTCCTTACAGACTGTTGCGGAGCTACTTCATTGTATGCCAGATGTAGCCTACTTTGCAAAGCTGATGACTGGTGGAATTATTTCGTTATCTGCTACATTAGCTTCAAACTTTGTATTTGAATCCTTTATTGGTGACTCTAAGGTATTTGAATCCTTACAATTTTTGGCATCCACCAAGTGGTTAAATACCTGTTTTCACGTTATTTTTATAACTTGAGGCCCTTTTGCATGGACACTCGTATTTTGCTCATGCTTTGGGCTGCACCGTTGCTGCAAAGTCCATTAAATGGTTTAAAGATCCTCAAACAAACCTGAATATAATTTCTGAAGGGACATCTCTCAGGGAGGTATGTGCGATCTATTTAAAGTTGTTCTTAAGTGGCTGGTAA ATGGGTTCCTTACAGACTGTTGCGGAGCTACTTCATTGTATGCCAGATGTAGCCTACTTTGCAAAGCTGATGACTGGTGGAATTATTTCGTTATCTGCTACATTAGCTTCAAACTTTGTATTTGAATCCTTTATTGGTGACTCTAAGGCCCTTTTGCATGGACACTCGTATTTTGCTCATGCTTTGGGCTGCACCGTTGCTGCAAAGTCCATTAAATGGTTTAAAGATCCTCAAACAAACCTGAATATAATTTCTGAAGGGACATCTCTCAGGGAGGTATGTGCGATCTATTTAAAGTTGTTCTTAAGTGGCTGGTAA ATGGGTTCCTTACAGACTGTTGCGGAGCTACTTCATTGTATGCCAGATGTAGCCTACTTTGCAAAGCTGATGACTGGTGGAATTATTTCGTTATCTGCTACATTAGCTTCAAACTTTGTATTTGAATCCTTTATTGGTGACTCTAAGGCCCTTTTGCATGGACACTCGTATTTTGCTCATGCTTTGGGCTGCACCGTTGCTGCAAAGTCCATTAAATGGTTTAAAGATCCTCAAACAAACCTGAATATAATTTCTGAAGGGACATCTCTCAGGGAGGTATGTGCGATCTATTTAAAGTTGTTCTTAAGTGGCTGGTAA MGSLQTVAELLHCMPDVAYFAKLMTGGIISLSATLASNFVFESFIGDSKALLHGHSYFAHALGCTVAAKSIKWFKDPQTNLNIISEGTSLREVCAIYLKLFLSGW Homology
BLAST of IVF0008072 vs. ExPASy Swiss-Prot
Match: B0F481 (Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=BIO3-BIO1 PE=1 SV=1) HSP 1 Score: 123.2 bits (308), Expect = 1.7e-27 Identity = 58/92 (63.04%), Postives = 75/92 (81.52%), Query Frame = 0
BLAST of IVF0008072 vs. ExPASy Swiss-Prot
Match: Q6ZKV8 (Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=BIO3-BIO1 PE=2 SV=1) HSP 1 Score: 109.0 bits (271), Expect = 3.3e-23 Identity = 51/92 (55.43%), Postives = 70/92 (76.09%), Query Frame = 0
BLAST of IVF0008072 vs. ExPASy Swiss-Prot
Match: Q5AYI6 (Bifunctional dethiobiotin synthetase/adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bioDA PE=1 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.7e-11 Identity = 36/67 (53.73%), Postives = 45/67 (67.16%), Query Frame = 0
BLAST of IVF0008072 vs. ExPASy Swiss-Prot
Match: B7GHM5 (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) OX=491915 GN=bioA PE=3 SV=1) HSP 1 Score: 57.0 bits (136), Expect = 1.5e-07 Identity = 31/89 (34.83%), Postives = 49/89 (55.06%), Query Frame = 0
BLAST of IVF0008072 vs. ExPASy Swiss-Prot
Match: Q728P4 (Adenosylmethionine-8-amino-7-oxononanoate aminotransferase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=bioA PE=3 SV=1) HSP 1 Score: 53.1 bits (126), Expect = 2.2e-06 Identity = 25/69 (36.23%), Postives = 41/69 (59.42%), Query Frame = 0
BLAST of IVF0008072 vs. ExPASy TrEMBL
Match: A0A5A7THL1 (Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold128G00860 PE=4 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 1.6e-36 Identity = 81/93 (87.10%), Postives = 84/93 (90.32%), Query Frame = 0
BLAST of IVF0008072 vs. ExPASy TrEMBL
Match: A0A5A7TST1 (Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold2741G00390 PE=4 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 2.3e-35 Identity = 80/95 (84.21%), Postives = 82/95 (86.32%), Query Frame = 0
BLAST of IVF0008072 vs. ExPASy TrEMBL
Match: A0A1S3BXI4 (bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial isoform X1 OS=Cucumis melo OX=3656 GN=LOC103494289 PE=3 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 6.7e-35 Identity = 80/98 (81.63%), Postives = 85/98 (86.73%), Query Frame = 0
BLAST of IVF0008072 vs. ExPASy TrEMBL
Match: A0A1S4E050 (bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial isoform X3 OS=Cucumis melo OX=3656 GN=LOC103494289 PE=3 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 6.7e-35 Identity = 80/98 (81.63%), Postives = 85/98 (86.73%), Query Frame = 0
BLAST of IVF0008072 vs. ExPASy TrEMBL
Match: A0A5D3C0K4 (Bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold83G002160 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 5.6e-34 Identity = 79/95 (83.16%), Postives = 82/95 (86.32%), Query Frame = 0
BLAST of IVF0008072 vs. NCBI nr
Match: KAA0041161.1 (bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase [Cucumis melo var. makuwa]) HSP 1 Score: 163 bits (412), Expect = 4.63e-49 Identity = 81/93 (87.10%), Postives = 84/93 (90.32%), Query Frame = 0
BLAST of IVF0008072 vs. NCBI nr
Match: KAA0044279.1 (bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase [Cucumis melo var. makuwa]) HSP 1 Score: 159 bits (402), Expect = 9.95e-48 Identity = 80/95 (84.21%), Postives = 82/95 (86.32%), Query Frame = 0
BLAST of IVF0008072 vs. NCBI nr
Match: TYK05503.1 (bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase [Cucumis melo var. makuwa]) HSP 1 Score: 154 bits (390), Expect = 6.27e-46 Identity = 79/95 (83.16%), Postives = 82/95 (86.32%), Query Frame = 0
BLAST of IVF0008072 vs. NCBI nr
Match: XP_008442133.1 (PREDICTED: bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial-like isoform X2 [Cucumis melo] >XP_008442134.1 PREDICTED: bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial-like isoform X2 [Cucumis melo]) HSP 1 Score: 147 bits (372), Expect = 6.74e-43 Identity = 76/103 (73.79%), Postives = 81/103 (78.64%), Query Frame = 0
BLAST of IVF0008072 vs. NCBI nr
Match: XP_008442130.1 (PREDICTED: bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial-like isoform X1 [Cucumis melo] >XP_008442131.1 PREDICTED: bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial-like isoform X1 [Cucumis melo] >XP_008442132.1 PREDICTED: bifunctional dethiobiotin synthetase/7,8-diamino-pelargonic acid aminotransferase, mitochondrial-like isoform X1 [Cucumis melo]) HSP 1 Score: 147 bits (372), Expect = 7.84e-43 Identity = 76/103 (73.79%), Postives = 81/103 (78.64%), Query Frame = 0
BLAST of IVF0008072 vs. TAIR 10
Match: AT5G57590.1 (adenosylmethionine-8-amino-7-oxononanoate transaminases ) HSP 1 Score: 123.2 bits (308), Expect = 1.2e-28 Identity = 58/92 (63.04%), Postives = 75/92 (81.52%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|