IVF0005943 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCATTCGGTTTAACGAATGCACCAACGGTCTTCATGGATCTCATGAACAGGATCTTCCATCAGTATTTAGATCAGTTTGTGATCGTGTTCATCGATGATATATTAGTTTACTCGGTTGACAGAGAAGCCCATGAGGAACATCTGAGGATTGTTCTACAGACTCTACGTGATAAACAGTTGTATGCTAAGTTCAGCAAATGTGAGTTCTGGTTGGAACAAGTAGTATTTTTGGGACATGTAGTTTCAGGAAAAGGAGTTAGTGTTGATCCACAAAAAGTAGAAGCGGTTGTCAATTGGGAAAGACCAACTAGTGCGACAGAAGTACGTAGTTTCCTGGGTTTGGCAGGATACTATAGGCGTTTTATTGAGGATTTCTCACGATTGGCATTGCCTTTGACTGCTTTGACAAGGAAGAATGCTAAGTTTGAGTGA ATGCCATTCGGTTTAACGAATGCACCAACGGTCTTCATGGATCTCATGAACAGGATCTTCCATCAGTATTTAGATCAGTTTGTGATCGTGTTCATCGATGATATATTAGTTTACTCGGTTGACAGAGAAGCCCATGAGGAACATCTGAGGATTGTTCTACAGACTCTACGTGATAAACAGTTGTATGCTAAGTTCAGCAAATGTGAGTTCTGGTTGGAACAAGTAGTATTTTTGGGACATGTAGTTTCAGGAAAAGGAGTTAGTGTTGATCCACAAAAAGTAGAAGCGGTTGTCAATTGGGAAAGACCAACTAGTGCGACAGAAGTACGTAGTTTCCTGGGTTTGGCAGGATACTATAGGCGTTTTATTGAGGATTTCTCACGATTGGCATTGCCTTTGACTGCTTTGACAAGGAAGAATGCTAAGTTTGAGTGA ATGCCATTCGGTTTAACGAATGCACCAACGGTCTTCATGGATCTCATGAACAGGATCTTCCATCAGTATTTAGATCAGTTTGTGATCGTGTTCATCGATGATATATTAGTTTACTCGGTTGACAGAGAAGCCCATGAGGAACATCTGAGGATTGTTCTACAGACTCTACGTGATAAACAGTTGTATGCTAAGTTCAGCAAATGTGAGTTCTGGTTGGAACAAGTAGTATTTTTGGGACATGTAGTTTCAGGAAAAGGAGTTAGTGTTGATCCACAAAAAGTAGAAGCGGTTGTCAATTGGGAAAGACCAACTAGTGCGACAGAAGTACGTAGTTTCCTGGGTTTGGCAGGATACTATAGGCGTTTTATTGAGGATTTCTCACGATTGGCATTGCCTTTGACTGCTTTGACAAGGAAGAATGCTAAGTTTGAGTGA MPFGLTNAPTVFMDLMNRIFHQYLDQFVIVFIDDILVYSVDREAHEEHLRIVLQTLRDKQLYAKFSKCEFWLEQVVFLGHVVSGKGVSVDPQKVEAVVNWERPTSATEVRSFLGLAGYYRRFIEDFSRLALPLTALTRKNAKFE Homology
BLAST of IVF0005943 vs. ExPASy Swiss-Prot
Match: P04323 (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 127.9 bits (320), Expect = 9.4e-29 Identity = 58/144 (40.28%), Postives = 90/144 (62.50%), Query Frame = 0
BLAST of IVF0005943 vs. ExPASy Swiss-Prot
Match: P20825 (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 4.7e-28 Identity = 57/144 (39.58%), Postives = 90/144 (62.50%), Query Frame = 0
BLAST of IVF0005943 vs. ExPASy Swiss-Prot
Match: Q8I7P9 (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 4.7e-28 Identity = 58/138 (42.03%), Postives = 90/138 (65.22%), Query Frame = 0
BLAST of IVF0005943 vs. ExPASy Swiss-Prot
Match: P10401 (Retrovirus-related Pol polyprotein from transposon gypsy OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 3.5e-23 Identity = 50/138 (36.23%), Postives = 83/138 (60.14%), Query Frame = 0
BLAST of IVF0005943 vs. ExPASy Swiss-Prot
Match: P92523 (Uncharacterized mitochondrial protein AtMg00860 OS=Arabidopsis thaliana OX=3702 GN=AtMg00860 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 8.5e-22 Identity = 47/96 (48.96%), Postives = 65/96 (67.71%), Query Frame = 0
BLAST of IVF0005943 vs. ExPASy TrEMBL
Match: A0A5A7TA17 (Putative gag-pol polyprotein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold270G003160 PE=4 SV=1) HSP 1 Score: 283.9 bits (725), Expect = 3.8e-73 Identity = 140/144 (97.22%), Postives = 142/144 (98.61%), Query Frame = 0
BLAST of IVF0005943 vs. ExPASy TrEMBL
Match: A0A5D3BEU1 (DNA/RNA polymerases superfamily protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold506G00190 PE=4 SV=1) HSP 1 Score: 283.9 bits (725), Expect = 3.8e-73 Identity = 140/144 (97.22%), Postives = 142/144 (98.61%), Query Frame = 0
BLAST of IVF0005943 vs. ExPASy TrEMBL
Match: A0A5A7UBV9 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold102G00060 PE=4 SV=1) HSP 1 Score: 282.3 bits (721), Expect = 1.1e-72 Identity = 140/144 (97.22%), Postives = 141/144 (97.92%), Query Frame = 0
BLAST of IVF0005943 vs. ExPASy TrEMBL
Match: A0A5A7T306 (DNA/RNA polymerases superfamily protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold349G00050 PE=4 SV=1) HSP 1 Score: 281.6 bits (719), Expect = 1.9e-72 Identity = 138/144 (95.83%), Postives = 140/144 (97.22%), Query Frame = 0
BLAST of IVF0005943 vs. ExPASy TrEMBL
Match: A0A5D3DZ50 (DNA/RNA polymerases superfamily protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold165G00500 PE=4 SV=1) HSP 1 Score: 280.8 bits (717), Expect = 3.2e-72 Identity = 140/144 (97.22%), Postives = 141/144 (97.92%), Query Frame = 0
BLAST of IVF0005943 vs. NCBI nr
Match: TYK25908.1 (Retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 278 bits (710), Expect = 1.25e-90 Identity = 137/144 (95.14%), Postives = 140/144 (97.22%), Query Frame = 0
BLAST of IVF0005943 vs. NCBI nr
Match: TYK23887.1 (DNA/RNA polymerases superfamily protein [Cucumis melo var. makuwa]) HSP 1 Score: 278 bits (710), Expect = 1.75e-90 Identity = 137/144 (95.14%), Postives = 140/144 (97.22%), Query Frame = 0
BLAST of IVF0005943 vs. NCBI nr
Match: KAA0061419.1 (reverse transcriptase [Cucumis melo var. makuwa]) HSP 1 Score: 280 bits (716), Expect = 1.14e-89 Identity = 140/144 (97.22%), Postives = 141/144 (97.92%), Query Frame = 0
BLAST of IVF0005943 vs. NCBI nr
Match: KAA0032755.1 (reverse transcriptase [Cucumis melo var. makuwa]) HSP 1 Score: 277 bits (709), Expect = 4.11e-89 Identity = 136/144 (94.44%), Postives = 140/144 (97.22%), Query Frame = 0
BLAST of IVF0005943 vs. NCBI nr
Match: KAA0036001.1 (DNA/RNA polymerases superfamily protein [Cucumis melo var. makuwa] >TYK30406.1 DNA/RNA polymerases superfamily protein [Cucumis melo var. makuwa]) HSP 1 Score: 281 bits (718), Expect = 5.39e-89 Identity = 138/144 (95.83%), Postives = 140/144 (97.22%), Query Frame = 0
BLAST of IVF0005943 vs. TAIR 10
Match: ATMG00860.1 (DNA/RNA polymerases superfamily protein ) HSP 1 Score: 104.8 bits (260), Expect = 6.1e-23 Identity = 47/96 (48.96%), Postives = 65/96 (67.71%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|