IVF0005766 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCAGCAACTAAAGGTCTTGTGTTTGTTATGCTTCTCATTGCTTTTGCTATGCTCCTTATGGAATCAGGCCAAATGGTAATCCTTCTTCCATGTTTTCTCTGTTCAGTTTTGACACTTTTCAACTTTTTGGTTTAACATCTACACGGTATGGTCTTTCAGATTATCACAACTCAGGTGGATAACCCTCTTCCTCAAGAGATAGGTAACGATGAGATTTGAGCACCTGCATTCACATTGTTATGTTAATGTTTTTTGCTTCGTGACCAAAATGTGTGCCTATTGCAGATTGTGGCAAAGCTTGTGATGCAAGGTGCCGATTATCGTCGAGGCAGAAGATCTGTAAGAGGGCATGTGGAACCTGTTGCGCTCGCTGTCAATGCGTTCCGCCAGGCACTTCAGGCAACTACGATGTTTGTCCCTGCTACGCTAATATGACCACACATGGTGGCAGGCACAAGTGTCCCTAG ATGGCAGCAACTAAAGGTCTTGTGTTTGTTATGCTTCTCATTGCTTTTGCTATGCTCCTTATGGAATCAGGCCAAATGATTATCACAACTCAGGTGGATAACCCTCTTCCTCAAGAGATAGATTGTGGCAAAGCTTGTGATGCAAGGTGCCGATTATCGTCGAGGCAGAAGATCTGTAAGAGGGCATGTGGAACCTGTTGCGCTCGCTGTCAATGCGTTCCGCCAGGCACTTCAGGCAACTACGATGTTTGTCCCTGCTACGCTAATATGACCACACATGGTGGCAGGCACAAGTGTCCCTAG ATGGCAGCAACTAAAGGTCTTGTGTTTGTTATGCTTCTCATTGCTTTTGCTATGCTCCTTATGGAATCAGGCCAAATGATTATCACAACTCAGGTGGATAACCCTCTTCCTCAAGAGATAGATTGTGGCAAAGCTTGTGATGCAAGGTGCCGATTATCGTCGAGGCAGAAGATCTGTAAGAGGGCATGTGGAACCTGTTGCGCTCGCTGTCAATGCGTTCCGCCAGGCACTTCAGGCAACTACGATGTTTGTCCCTGCTACGCTAATATGACCACACATGGTGGCAGGCACAAGTGTCCCTAG MAATKGLVFVMLLIAFAMLLMESGQMIITTQVDNPLPQEIDCGKACDARCRLSSRQKICKRACGTCCARCQCVPPGTSGNYDVCPCYANMTTHGGRHKCP Homology
BLAST of IVF0005766 vs. ExPASy Swiss-Prot
Match: Q93X17 (Snakin-2 OS=Solanum tuberosum OX=4113 GN=SN2 PE=1 SV=1) HSP 1 Score: 116.3 bits (290), Expect = 2.0e-25 Identity = 61/107 (57.01%), Postives = 73/107 (68.22%), Query Frame = 0
BLAST of IVF0005766 vs. ExPASy Swiss-Prot
Match: P46689 (Gibberellin-regulated protein 1 OS=Arabidopsis thaliana OX=3702 GN=GASA1 PE=2 SV=2) HSP 1 Score: 113.6 bits (283), Expect = 1.3e-24 Identity = 54/100 (54.00%), Postives = 70/100 (70.00%), Query Frame = 0
BLAST of IVF0005766 vs. ExPASy Swiss-Prot
Match: F4IQJ4 (Gibberellin-regulated protein 11 OS=Arabidopsis thaliana OX=3702 GN=GASA11 PE=3 SV=1) HSP 1 Score: 105.5 bits (262), Expect = 3.5e-22 Identity = 52/95 (54.74%), Postives = 64/95 (67.37%), Query Frame = 0
BLAST of IVF0005766 vs. ExPASy Swiss-Prot
Match: P46688 (Gibberellin-regulated protein 2 OS=Arabidopsis thaliana OX=3702 GN=GASA2 PE=2 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.5e-20 Identity = 42/62 (67.74%), Postives = 49/62 (79.03%), Query Frame = 0
BLAST of IVF0005766 vs. ExPASy Swiss-Prot
Match: Q8GWK5 (Gibberellin-regulated protein 9 OS=Arabidopsis thaliana OX=3702 GN=GASA9 PE=3 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 9.5e-20 Identity = 40/61 (65.57%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of IVF0005766 vs. ExPASy TrEMBL
Match: A0A5A7V5C1 (Gibberellin-regulated protein 1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold455G008080 PE=3 SV=1) HSP 1 Score: 209.1 bits (531), Expect = 8.2e-51 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of IVF0005766 vs. ExPASy TrEMBL
Match: A0A1S3CRE3 (gibberellin-regulated protein 1-like OS=Cucumis melo OX=3656 GN=LOC103503877 PE=3 SV=1) HSP 1 Score: 209.1 bits (531), Expect = 8.2e-51 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of IVF0005766 vs. ExPASy TrEMBL
Match: A0A0A0LGH8 (Gibberellin-regulated protein 1 OS=Cucumis sativus OX=3659 GN=Csa_3G872160 PE=3 SV=1) HSP 1 Score: 199.1 bits (505), Expect = 8.5e-48 Identity = 92/100 (92.00%), Postives = 99/100 (99.00%), Query Frame = 0
BLAST of IVF0005766 vs. ExPASy TrEMBL
Match: A0A6J1IHC1 (snakin-2-like OS=Cucurbita maxima OX=3661 GN=LOC111475493 PE=3 SV=1) HSP 1 Score: 189.1 bits (479), Expect = 8.8e-45 Identity = 90/101 (89.11%), Postives = 96/101 (95.05%), Query Frame = 0
BLAST of IVF0005766 vs. ExPASy TrEMBL
Match: A0A6J1CLA3 (gibberellin-regulated protein 1-like OS=Momordica charantia OX=3673 GN=LOC111012644 PE=3 SV=1) HSP 1 Score: 186.0 bits (471), Expect = 7.5e-44 Identity = 85/100 (85.00%), Postives = 95/100 (95.00%), Query Frame = 0
BLAST of IVF0005766 vs. NCBI nr
Match: XP_008466485.1 (PREDICTED: gibberellin-regulated protein 1-like [Cucumis melo] >KAA0063283.1 gibberellin-regulated protein 1-like [Cucumis melo var. makuwa] >TYK31492.1 gibberellin-regulated protein 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 207 bits (528), Expect = 1.28e-67 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of IVF0005766 vs. NCBI nr
Match: XP_004136384.1 (gibberellin-regulated protein 1 [Cucumis sativus]) HSP 1 Score: 197 bits (502), Expect = 1.18e-63 Identity = 92/100 (92.00%), Postives = 99/100 (99.00%), Query Frame = 0
BLAST of IVF0005766 vs. NCBI nr
Match: XP_038900123.1 (gibberellin-regulated protein 1-like [Benincasa hispida]) HSP 1 Score: 190 bits (482), Expect = 1.37e-60 Identity = 93/101 (92.08%), Postives = 94/101 (93.07%), Query Frame = 0
BLAST of IVF0005766 vs. NCBI nr
Match: KAG6591269.1 (Snakin-2, partial [Cucurbita argyrosperma subsp. sororia] >KAG7024153.1 Snakin-2 [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 188 bits (478), Expect = 5.60e-60 Identity = 91/101 (90.10%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of IVF0005766 vs. NCBI nr
Match: XP_022975660.1 (snakin-2-like [Cucurbita maxima]) HSP 1 Score: 187 bits (476), Expect = 1.13e-59 Identity = 90/101 (89.11%), Postives = 96/101 (95.05%), Query Frame = 0
BLAST of IVF0005766 vs. TAIR 10
Match: AT1G75750.2 (GAST1 protein homolog 1 ) HSP 1 Score: 114.8 bits (286), Expect = 4.1e-26 Identity = 54/100 (54.00%), Postives = 70/100 (70.00%), Query Frame = 0
BLAST of IVF0005766 vs. TAIR 10
Match: AT1G75750.1 (GAST1 protein homolog 1 ) HSP 1 Score: 113.6 bits (283), Expect = 9.1e-26 Identity = 54/100 (54.00%), Postives = 70/100 (70.00%), Query Frame = 0
BLAST of IVF0005766 vs. TAIR 10
Match: AT2G18420.1 (Gibberellin-regulated family protein ) HSP 1 Score: 105.5 bits (262), Expect = 2.5e-23 Identity = 52/95 (54.74%), Postives = 64/95 (67.37%), Query Frame = 0
BLAST of IVF0005766 vs. TAIR 10
Match: AT4G09610.1 (GAST1 protein homolog 2 ) HSP 1 Score: 100.1 bits (248), Expect = 1.0e-21 Identity = 42/62 (67.74%), Postives = 49/62 (79.03%), Query Frame = 0
BLAST of IVF0005766 vs. TAIR 10
Match: AT1G22690.1 (Gibberellin-regulated family protein ) HSP 1 Score: 97.4 bits (241), Expect = 6.7e-21 Identity = 40/61 (65.57%), Postives = 49/61 (80.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|