IVF0004373 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCATATATTTTGTGTTTGTTTCCATTTAATTTGGAATGTTACCTCAACCTTTCATAATTTCGTGTTTATGTGTTGCACATGCCTTACTTGGTTGGTATATGTTGTGAGAATGGAGTTTCTTGTGGTAGGACATGGAGTAGCCAATGGTAGGTCTAAGCAAAGTAGAAGTGAGAAAAAGAGTCGTAAAGCAATGCTGAAGCTTGGAATGAAGCCTATCTCCGGTGTGAGCCATGTCACAGTCAAGAAGAGTAAAAATGTTAGTTTTTTTCAACATCTCAAATTTGACACTTCTAAATTGATTCTATCTAATATCTATGGCATTTTCTCTGCAGATGTTATCTAA ATGCATATATTTTGTGTTTGTTTCCATTTAATTTGGAATGTTACCTCAACCTTTCATAATTTCGTGTTTATGTGTTGCACATGCCTTACTTGGTTGGTATATGTTGTGAGAATGGAGTTTCTTGTGGTAGGACATGGAGTAGCCAATGGTAGGTCTAAGCAAAGTAGAAGTGAGAAAAAGAGTCGTAAAGCAATGCTGAAGCTTGGAATGAAGCCTATCTCCGGTGTGAGCCATGTCACAGTCAAGAAGAGTAAAAATGTTAGTTTTTTTCAACATCTCAAATTTGACACTTCTAAATTGATTCTATCTAATATCTATGGCATTTTCTCTGCAGATGTTATCTAA ATGCATATATTTTGTGTTTGTTTCCATTTAATTTGGAATGTTACCTCAACCTTTCATAATTTCGTGTTTATGTGTTGCACATGCCTTACTTGGTTGGTATATGTTGTGAGAATGGAGTTTCTTGTGGTAGGACATGGAGTAGCCAATGGTAGGTCTAAGCAAAGTAGAAGTGAGAAAAAGAGTCGTAAAGCAATGCTGAAGCTTGGAATGAAGCCTATCTCCGGTGTGAGCCATGTCACAGTCAAGAAGAGTAAAAATGTTAGTTTTTTTCAACATCTCAAATTTGACACTTCTAAATTGATTCTATCTAATATCTATGGCATTTTCTCTGCAGATGTTATCTAA MHIFCVCFHLIWNVTSTFHNFVFMCCTCLTWLVYVVRMEFLVVGHGVANGRSKQSRSEKKSRKAMLKLGMKPISGVSHVTVKKSKNVSFFQHLKFDTSKLILSNIYGIFSADVI Homology
BLAST of IVF0004373 vs. ExPASy Swiss-Prot
Match: Q6ICZ8 (Nascent polypeptide-associated complex subunit alpha-like protein 3 OS=Arabidopsis thaliana OX=3702 GN=At5g13850 PE=1 SV=1) HSP 1 Score: 75.1 bits (183), Expect = 5.7e-13 Identity = 47/67 (70.15%), Postives = 50/67 (74.63%), Query Frame = 0
BLAST of IVF0004373 vs. ExPASy Swiss-Prot
Match: Q9LHG9 (Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=At3g12390 PE=1 SV=1) HSP 1 Score: 73.2 bits (178), Expect = 2.2e-12 Identity = 44/64 (68.75%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of IVF0004373 vs. ExPASy Swiss-Prot
Match: Q94JX9 (Nascent polypeptide-associated complex subunit alpha-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=At3g49470 PE=2 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 7.0e-11 Identity = 40/61 (65.57%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of IVF0004373 vs. ExPASy Swiss-Prot
Match: Q9M612 (Nascent polypeptide-associated complex subunit alpha-like protein OS=Pinus taeda OX=3352 PE=2 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 7.0e-11 Identity = 34/46 (73.91%), Postives = 38/46 (82.61%), Query Frame = 0
BLAST of IVF0004373 vs. ExPASy Swiss-Prot
Match: Q9SZY1 (Nascent polypeptide-associated complex subunit alpha-like protein 4 OS=Arabidopsis thaliana OX=3702 GN=At4g10480 PE=1 SV=1) HSP 1 Score: 62.8 bits (151), Expect = 2.9e-09 Identity = 39/61 (63.93%), Postives = 43/61 (70.49%), Query Frame = 0
BLAST of IVF0004373 vs. ExPASy TrEMBL
Match: A0A0A0KYD5 (Nascent polypeptide associated complex alpha OS=Cucumis sativus OX=3659 GN=Csa_4G420110 PE=4 SV=1) HSP 1 Score: 144.1 bits (362), Expect = 3.7e-31 Identity = 77/109 (70.64%), Postives = 86/109 (78.90%), Query Frame = 0
BLAST of IVF0004373 vs. ExPASy TrEMBL
Match: A0A5D3BN41 (Nascent polypeptide associated complex alpha OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold2510G00290 PE=4 SV=1) HSP 1 Score: 137.5 bits (345), Expect = 3.5e-29 Identity = 72/77 (93.51%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of IVF0004373 vs. ExPASy TrEMBL
Match: A0A5D3DV27 (Nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold236G00100 PE=4 SV=1) HSP 1 Score: 130.6 bits (327), Expect = 4.3e-27 Identity = 69/74 (93.24%), Postives = 70/74 (94.59%), Query Frame = 0
BLAST of IVF0004373 vs. ExPASy TrEMBL
Match: A0A6J1EAG7 (nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Cucurbita moschata OX=3662 GN=LOC111432347 PE=4 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 5.0e-12 Identity = 47/66 (71.21%), Postives = 51/66 (77.27%), Query Frame = 0
BLAST of IVF0004373 vs. ExPASy TrEMBL
Match: A0A6J1DM87 (nascent polypeptide-associated complex subunit alpha-like protein 1 OS=Momordica charantia OX=3673 GN=LOC111021750 PE=4 SV=1) HSP 1 Score: 79.7 bits (195), Expect = 8.6e-12 Identity = 48/68 (70.59%), Postives = 51/68 (75.00%), Query Frame = 0
BLAST of IVF0004373 vs. NCBI nr
Match: TYK00142.1 (Nascent polypeptide associated complex alpha [Cucumis melo var. makuwa]) HSP 1 Score: 137 bits (344), Expect = 1.30e-39 Identity = 72/77 (93.51%), Postives = 73/77 (94.81%), Query Frame = 0
BLAST of IVF0004373 vs. NCBI nr
Match: KAA0048577.1 (nascent polypeptide-associated complex subunit alpha-like protein 1 [Cucumis melo var. makuwa] >TYK27165.1 nascent polypeptide-associated complex subunit alpha-like protein 1 [Cucumis melo var. makuwa]) HSP 1 Score: 130 bits (326), Expect = 1.74e-36 Identity = 70/80 (87.50%), Postives = 72/80 (90.00%), Query Frame = 0
BLAST of IVF0004373 vs. NCBI nr
Match: XP_022924957.1 (nascent polypeptide-associated complex subunit alpha-like protein 1 [Cucurbita moschata]) HSP 1 Score: 80.1 bits (196), Expect = 8.42e-16 Identity = 41/46 (89.13%), Postives = 43/46 (93.48%), Query Frame = 0
BLAST of IVF0004373 vs. NCBI nr
Match: KAF5941100.1 (hypothetical protein HYC85_022267 [Camellia sinensis]) HSP 1 Score: 80.1 bits (196), Expect = 1.02e-15 Identity = 48/84 (57.14%), Postives = 59/84 (70.24%), Query Frame = 0
BLAST of IVF0004373 vs. NCBI nr
Match: XP_022154479.1 (nascent polypeptide-associated complex subunit alpha-like protein 1 [Momordica charantia]) HSP 1 Score: 79.3 bits (194), Expect = 1.67e-15 Identity = 48/68 (70.59%), Postives = 51/68 (75.00%), Query Frame = 0
BLAST of IVF0004373 vs. TAIR 10
Match: AT5G13850.1 (nascent polypeptide-associated complex subunit alpha-like protein 3 ) HSP 1 Score: 75.1 bits (183), Expect = 4.1e-14 Identity = 47/67 (70.15%), Postives = 50/67 (74.63%), Query Frame = 0
BLAST of IVF0004373 vs. TAIR 10
Match: AT3G12390.1 (Nascent polypeptide-associated complex (NAC), alpha subunit family protein ) HSP 1 Score: 73.2 bits (178), Expect = 1.5e-13 Identity = 44/64 (68.75%), Postives = 48/64 (75.00%), Query Frame = 0
BLAST of IVF0004373 vs. TAIR 10
Match: AT3G49470.1 (nascent polypeptide-associated complex subunit alpha-like protein 2 ) HSP 1 Score: 68.2 bits (165), Expect = 5.0e-12 Identity = 40/61 (65.57%), Postives = 46/61 (75.41%), Query Frame = 0
BLAST of IVF0004373 vs. TAIR 10
Match: AT4G10480.1 (Nascent polypeptide-associated complex (NAC), alpha subunit family protein ) HSP 1 Score: 62.8 bits (151), Expect = 2.1e-10 Identity = 39/61 (63.93%), Postives = 43/61 (70.49%), Query Frame = 0
BLAST of IVF0004373 vs. TAIR 10
Match: AT4G10480.2 (Nascent polypeptide-associated complex (NAC), alpha subunit family protein ) HSP 1 Score: 62.8 bits (151), Expect = 2.1e-10 Identity = 39/61 (63.93%), Postives = 43/61 (70.49%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|