
IVF0003970 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTCCATCTTCCATTCAAAAATCCTTTGAAGTTTTAATTTGGAAGGAGGGTGAGAGTTGGTCTTTTGATGATGGTCTTAAGAGCATGTACAATGCAAATAACCGTGGGAAACAACAGGTCATGATCATGTTGTCTTCCAAAGTTATCATCAAGTTTCTTCTGGTTTGCAGAAGCATAATTATATTAGTGAATTTGAGTTTGTCAATGATCATAGATCTGGAAAAATTGTTTTTGAATTCAACGATAGGCTGAACAAATGTGGGGTTATTAATCCTTGTTTTGACGTGGGTGTTAAGGAAATTGAAGGTTGAATTGCTAGGTTGCTCCATTCGAGACAGTTTGGATTCATTGTGTTGACAACTTCTGCTGGAATTATGGAACATGCAGAAGCAAGAAGGAAGAATGTTGGAGGCAAAGTTCTTAGTTTCTTCTACTGA ATGCCTCCATCTTCCATTCAAAAATCCTTTGAAGTTTTAATTTGGAAGGAGGGTGAGAGTTGGTCTTTTGATGATGGTCTTAAGAGCATGTACAATGCAAATAACCGTGGGAAACAACAGGTCATGATCATGTTGTCTTCCAAAGTTATCATCAAGTTTCTTCTGTTTGTCAATGATCATAGATCTGGAAAAATTGTTTTTGAATTCAACGATAGGCTGAACAAATGTGGGGTTATTAATCCTTGTTTTGACGTGGGTTTTGGATTCATTGTGTTGACAACTTCTGCTGGAATTATGGAACATGCAGAAGCAAGAAGGAAGAATGTTGGAGGCAAAGTTCTTAGTTTCTTCTACTGA ATGCCTCCATCTTCCATTCAAAAATCCTTTGAAGTTTTAATTTGGAAGGAGGGTGAGAGTTGGTCTTTTGATGATGGTCTTAAGAGCATGTACAATGCAAATAACCGTGGGAAACAACAGGTCATGATCATGTTGTCTTCCAAAGTTATCATCAAGTTTCTTCTGTTTGTCAATGATCATAGATCTGGAAAAATTGTTTTTGAATTCAACGATAGGCTGAACAAATGTGGGGTTATTAATCCTTGTTTTGACGTGGGTTTTGGATTCATTGTGTTGACAACTTCTGCTGGAATTATGGAACATGCAGAAGCAAGAAGGAAGAATGTTGGAGGCAAAGTTCTTAGTTTCTTCTACTGA MPPSSIQKSFEVLIWKEGESWSFDDGLKSMYNANNRGKQQVMIMLSSKVIIKFLLFVNDHRSGKIVFEFNDRLNKCGVINPCFDVGFGFIVLTTSAGIMEHAEARRKNVGGKVLSFFY Homology
BLAST of IVF0003970 vs. ExPASy Swiss-Prot
Match: Q9LX88 (40S ribosomal protein S15a-4 OS=Arabidopsis thaliana OX=3702 GN=RPS15AD PE=2 SV=3) HSP 1 Score: 141.7 bits (356), Expect = 5.2e-33 Identity = 78/123 (63.41%), Postives = 85/123 (69.11%), Query Frame = 0
BLAST of IVF0003970 vs. ExPASy Swiss-Prot
Match: P42798 (40S ribosomal protein S15a-1 OS=Arabidopsis thaliana OX=3702 GN=RPS15AA PE=2 SV=2) HSP 1 Score: 138.3 bits (347), Expect = 5.7e-32 Identity = 76/123 (61.79%), Postives = 84/123 (68.29%), Query Frame = 0
BLAST of IVF0003970 vs. ExPASy Swiss-Prot
Match: Q00332 (40S ribosomal protein S15a OS=Brassica napus OX=3708 GN=RPS15A PE=2 SV=3) HSP 1 Score: 136.7 bits (343), Expect = 1.7e-31 Identity = 75/123 (60.98%), Postives = 84/123 (68.29%), Query Frame = 0
BLAST of IVF0003970 vs. ExPASy Swiss-Prot
Match: Q9AT34 (40S ribosomal protein S15a OS=Daucus carota OX=4039 GN=RPS15A PE=2 SV=3) HSP 1 Score: 136.3 bits (342), Expect = 2.2e-31 Identity = 74/123 (60.16%), Postives = 84/123 (68.29%), Query Frame = 0
BLAST of IVF0003970 vs. ExPASy Swiss-Prot
Match: O80646 (40S ribosomal protein S15a-3 OS=Arabidopsis thaliana OX=3702 GN=RPS15AC PE=2 SV=2) HSP 1 Score: 125.6 bits (314), Expect = 3.8e-28 Identity = 70/123 (56.91%), Postives = 81/123 (65.85%), Query Frame = 0
BLAST of IVF0003970 vs. ExPASy TrEMBL
Match: A0A3N6S0C1 (Uncharacterized protein OS=Brassica cretica OX=69181 GN=DY000_00025936 PE=3 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 8.6e-31 Identity = 77/123 (62.60%), Postives = 85/123 (69.11%), Query Frame = 0
BLAST of IVF0003970 vs. ExPASy TrEMBL
Match: A0A6A4KFU8 (Uncharacterized protein (Fragment) OS=Rhododendron williamsianum OX=262921 GN=C3L33_22777 PE=3 SV=1) HSP 1 Score: 142.9 bits (359), Expect = 8.6e-31 Identity = 77/107 (71.96%), Postives = 82/107 (76.64%), Query Frame = 0
BLAST of IVF0003970 vs. ExPASy TrEMBL
Match: A0A178VIE3 (RPS15AD OS=Arabidopsis thaliana OX=3702 GN=AXX17_At3g39900 PE=3 SV=1) HSP 1 Score: 141.7 bits (356), Expect = 1.9e-30 Identity = 78/123 (63.41%), Postives = 85/123 (69.11%), Query Frame = 0
BLAST of IVF0003970 vs. ExPASy TrEMBL
Match: A0A1S3CPB7 (40S ribosomal protein S15a-1 OS=Cucumis melo OX=3656 GN=LOC103503055 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 2.5e-30 Identity = 79/123 (64.23%), Postives = 84/123 (68.29%), Query Frame = 0
BLAST of IVF0003970 vs. ExPASy TrEMBL
Match: A0A5A7SSH5 (40S ribosomal protein S15a-1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold49G00840 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 2.5e-30 Identity = 79/123 (64.23%), Postives = 84/123 (68.29%), Query Frame = 0
BLAST of IVF0003970 vs. NCBI nr
Match: KAE9445325.1 (hypothetical protein C3L33_22777, partial [Rhododendron williamsianum]) HSP 1 Score: 142 bits (359), Expect = 3.45e-41 Identity = 77/107 (71.96%), Postives = 82/107 (76.64%), Query Frame = 0
BLAST of IVF0003970 vs. NCBI nr
Match: NP_190190.1 (ribosomal protein S15A D [Arabidopsis thaliana] >Q9LX88.3 RecName: Full=40S ribosomal protein S15a-4 [Arabidopsis thaliana] >KAG7627496.1 Ribosomal protein S8 superfamily [Arabidopsis thaliana x Arabidopsis arenosa] >KAG7633440.1 Ribosomal protein S8 superfamily [Arabidopsis suecica] >AAK76511.1 putative cytoplasmic ribosomal protein S15a [Arabidopsis thaliana] >AAM14312.1 putative cytoplasmic ribosomal protein S15a [Arabidopsis thaliana] >AEE78104.1 ribosomal protein S15A D [Arabidopsis thaliana]) HSP 1 Score: 141 bits (356), Expect = 1.12e-40 Identity = 78/123 (63.41%), Postives = 85/123 (69.11%), Query Frame = 0
BLAST of IVF0003970 vs. NCBI nr
Match: XP_038706844.1 (40S ribosomal protein S15a-1-like [Tripterygium wilfordii] >KAF5744634.1 40S ribosomal protein S15a-1-like [Tripterygium wilfordii]) HSP 1 Score: 141 bits (355), Expect = 1.58e-40 Identity = 76/123 (61.79%), Postives = 85/123 (69.11%), Query Frame = 0
BLAST of IVF0003970 vs. NCBI nr
Match: XP_004144630.1 (40S ribosomal protein S15a-1 [Cucumis sativus] >XP_008457542.1 PREDICTED: 40S ribosomal protein S15a-1 [Cucumis melo] >XP_008465450.1 PREDICTED: 40S ribosomal protein S15a-1 [Cucumis melo] >XP_011657911.1 40S ribosomal protein S15a-1 [Cucumis sativus] >XP_038893650.1 40S ribosomal protein S15a-1 [Benincasa hispida] >XP_038897125.1 40S ribosomal protein S15a-1 [Benincasa hispida] >KAA0033910.1 40S ribosomal protein S15a-1 [Cucumis melo var. makuwa] >BAA89231.1 wrp15a [Citrullus lanatus] >KAA0052378.1 40S ribosomal protein S15a-1 [Cucumis melo var. makuwa] >KAE8649788.1 hypothetical protein Csa_011988 [Cucumis sativus] >KAE8653230.1 hypothetical protein Csa_019672 [Cucumis sativus]) HSP 1 Score: 141 bits (355), Expect = 1.58e-40 Identity = 79/123 (64.23%), Postives = 84/123 (68.29%), Query Frame = 0
BLAST of IVF0003970 vs. NCBI nr
Match: KAG5557696.1 (hypothetical protein RHGRI_007820 [Rhododendron griersonianum]) HSP 1 Score: 141 bits (356), Expect = 1.87e-40 Identity = 82/136 (60.29%), Postives = 88/136 (64.71%), Query Frame = 0
BLAST of IVF0003970 vs. TAIR 10
Match: AT3G46040.1 (ribosomal protein S15A D ) HSP 1 Score: 141.7 bits (356), Expect = 3.7e-34 Identity = 78/123 (63.41%), Postives = 85/123 (69.11%), Query Frame = 0
BLAST of IVF0003970 vs. TAIR 10
Match: AT1G07770.1 (ribosomal protein S15A ) HSP 1 Score: 138.3 bits (347), Expect = 4.1e-33 Identity = 76/123 (61.79%), Postives = 84/123 (68.29%), Query Frame = 0
BLAST of IVF0003970 vs. TAIR 10
Match: AT1G07770.2 (ribosomal protein S15A ) HSP 1 Score: 138.3 bits (347), Expect = 4.1e-33 Identity = 76/123 (61.79%), Postives = 84/123 (68.29%), Query Frame = 0
BLAST of IVF0003970 vs. TAIR 10
Match: AT5G59850.1 (Ribosomal protein S8 family protein ) HSP 1 Score: 138.3 bits (347), Expect = 4.1e-33 Identity = 76/123 (61.79%), Postives = 84/123 (68.29%), Query Frame = 0
BLAST of IVF0003970 vs. TAIR 10
Match: AT2G39590.1 (Ribosomal protein S8 family protein ) HSP 1 Score: 125.6 bits (314), Expect = 2.7e-29 Identity = 70/123 (56.91%), Postives = 81/123 (65.85%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|