IVF0003358 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTACGACGAAAGTGATGTAGCGGTAGGAGCTATGCTAGGTCAAAAGGAGGATAAAATGATTCATCTTAGATCCTACACAAGCAAGACTCTGAATGAAGGTCAAGAGAACTACACAACCACAAAAAAGGAATTGCTCGCGGTAGTATTCGAGATAGAGAAATATAGGAGCTACATTATTGGTTCCAAAGTCACGATACACTCTAAATCATTCTGTGATCAGATATTTGATGGCAAAGGACACCAAGCTGCGAATCAAATGGATATTATTGCTCCAAGAATTTGA ATGTACGACGAAAGTGATGTAGCGGTAGGAGCTATGCTAGGTCAAAAGGAGGATAAAATGATTCATCTTAGATCCTACACAAGCAAGACTCTGAATGAAGGTCAAGAGAACTACACAACCACAAAAAAGGAATTGCTCGCGGTAGTATTCGAGATAGAGAAATATAGGAGCTACATTATTGGTTCCAAAGTCACGATACACTCTAAATCATTCTGTGATCAGATATTTGATGGCAAAGGACACCAAGCTGCGAATCAAATGGATATTATTGCTCCAAGAATTTGA ATGTACGACGAAAGTGATGTAGCGGTAGGAGCTATGCTAGGTCAAAAGGAGGATAAAATGATTCATCTTAGATCCTACACAAGCAAGACTCTGAATGAAGGTCAAGAGAACTACACAACCACAAAAAAGGAATTGCTCGCGGTAGTATTCGAGATAGAGAAATATAGGAGCTACATTATTGGTTCCAAAGTCACGATACACTCTAAATCATTCTGTGATCAGATATTTGATGGCAAAGGACACCAAGCTGCGAATCAAATGGATATTATTGCTCCAAGAATTTGA MYDESDVAVGAMLGQKEDKMIHLRSYTSKTLNEGQENYTTTKKELLAVVFEIEKYRSYIIGSKVTIHSKSFCDQIFDGKGHQAANQMDIIAPRI Homology
BLAST of IVF0003358 vs. ExPASy Swiss-Prot
Match: P04323 (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 3.9e-07 Identity = 31/66 (46.97%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of IVF0003358 vs. ExPASy Swiss-Prot
Match: Q8I7P9 (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 50.1 bits (118), Expect = 1.6e-05 Identity = 22/60 (36.67%), Postives = 41/60 (68.33%), Query Frame = 0
BLAST of IVF0003358 vs. ExPASy Swiss-Prot
Match: P20825 (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 48.1 bits (113), Expect = 6.2e-05 Identity = 26/66 (39.39%), Postives = 43/66 (65.15%), Query Frame = 0
BLAST of IVF0003358 vs. ExPASy Swiss-Prot
Match: Q9UR07 (Transposon Tf2-11 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-11 PE=3 SV=1) HSP 1 Score: 44.3 bits (103), Expect = 8.9e-04 Identity = 23/58 (39.66%), Postives = 38/58 (65.52%), Query Frame = 0
BLAST of IVF0003358 vs. ExPASy Swiss-Prot
Match: P0CT41 (Transposon Tf2-12 polyprotein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=Tf2-12 PE=3 SV=1) HSP 1 Score: 44.3 bits (103), Expect = 8.9e-04 Identity = 23/58 (39.66%), Postives = 38/58 (65.52%), Query Frame = 0
BLAST of IVF0003358 vs. ExPASy TrEMBL
Match: A0A5A7US86 (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold120G002330 PE=4 SV=1) HSP 1 Score: 189.9 bits (481), Expect = 4.9e-45 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 0
BLAST of IVF0003358 vs. ExPASy TrEMBL
Match: A0A5A7V8R9 (RT_RNaseH domain-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold313G003510 PE=4 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 8.7e-18 Identity = 52/71 (73.24%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of IVF0003358 vs. ExPASy TrEMBL
Match: A0A5A7TFL9 (Transposon Ty3-I Gag-Pol polyprotein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold35G00930 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 7.3e-17 Identity = 48/66 (72.73%), Postives = 57/66 (86.36%), Query Frame = 0
BLAST of IVF0003358 vs. ExPASy TrEMBL
Match: A0A5D3DZR6 (Transposon Ty3-I Gag-Pol polyprotein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold2406G00210 PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 7.3e-17 Identity = 48/66 (72.73%), Postives = 57/66 (86.36%), Query Frame = 0
BLAST of IVF0003358 vs. ExPASy TrEMBL
Match: A0A5D3C0M6 (Pol polyprotein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold143G001400 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 1.2e-16 Identity = 46/67 (68.66%), Postives = 55/67 (82.09%), Query Frame = 0
BLAST of IVF0003358 vs. NCBI nr
Match: KAA0056421.1 (Retrovirus-related Pol polyprotein from transposon 17.6 [Cucumis melo var. makuwa] >TYK29099.1 Retrovirus-related Pol polyprotein from transposon 17.6 [Cucumis melo var. makuwa]) HSP 1 Score: 189 bits (481), Expect = 1.22e-60 Identity = 94/94 (100.00%), Postives = 94/94 (100.00%), Query Frame = 0
BLAST of IVF0003358 vs. NCBI nr
Match: KAA0062295.1 (hypothetical protein E6C27_scaffold154G00380 [Cucumis melo var. makuwa] >TYK26691.1 hypothetical protein E5676_scaffold313G003510 [Cucumis melo var. makuwa]) HSP 1 Score: 100 bits (250), Expect = 3.87e-25 Identity = 52/71 (73.24%), Postives = 57/71 (80.28%), Query Frame = 0
BLAST of IVF0003358 vs. NCBI nr
Match: KAA0066344.1 (reverse transcriptase [Cucumis melo var. makuwa] >TYK00934.1 reverse transcriptase [Cucumis melo var. makuwa]) HSP 1 Score: 94.4 bits (233), Expect = 3.23e-22 Identity = 44/69 (63.77%), Postives = 58/69 (84.06%), Query Frame = 0
BLAST of IVF0003358 vs. NCBI nr
Match: KAA0040451.1 (Transposon Ty3-I Gag-Pol polyprotein [Cucumis melo var. makuwa]) HSP 1 Score: 97.8 bits (242), Expect = 7.01e-22 Identity = 48/66 (72.73%), Postives = 57/66 (86.36%), Query Frame = 0
BLAST of IVF0003358 vs. NCBI nr
Match: TYK28899.1 (Transposon Ty3-I Gag-Pol polyprotein [Cucumis melo var. makuwa]) HSP 1 Score: 97.8 bits (242), Expect = 7.01e-22 Identity = 48/66 (72.73%), Postives = 57/66 (86.36%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|