IVF0003111 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGGAATCAAATATGCAGTATTTACAGACAAAAGTATTCGGTTATTGGGGAAAAAGAAATATACTGATAATGTCGAATCAGGATCAACTAGGACAGAAATCAAGCATTGGGTCGAACTCTTCTTTGGTGTCAAGGTAATAGCTATTCATAGTCATCGACTCCCGGGAAAGGGTAGAAGAATGGGACCTATTATGGGACATACAATGCATTACAGACGTGAATATGGAATTTCATGA ATGGATGGAATCAAATATGCAGTATTTACAGACAAAAGTATTCGGTTATTGGGGAAAAAGAAATATACTGATAATGTCGAATCAGGATCAACTAGGACAGAAATCAAGCATTGGGTCGAACTCTTCTTTGGTGTCAAGGTAATAGCTATTCATAGTCATCGACTCCCGGGAAAGGGTAGAAGAATGGGACCTATTATGGGACATACAATGCATTACAGACGTGAATATGGAATTTCATGA ATGGATGGAATCAAATATGCAGTATTTACAGACAAAAGTATTCGGTTATTGGGGAAAAAGAAATATACTGATAATGTCGAATCAGGATCAACTAGGACAGAAATCAAGCATTGGGTCGAACTCTTCTTTGGTGTCAAGGTAATAGCTATTCATAGTCATCGACTCCCGGGAAAGGGTAGAAGAATGGGACCTATTATGGGACATACAATGCATTACAGACGTGAATATGGAATTTCATGA MDGIKYAVFTDKSIRLLGKKKYTDNVESGSTRTEIKHWVELFFGVKVIAIHSHRLPGKGRRMGPIMGHTMHYRREYGIS Homology
BLAST of IVF0003111 vs. ExPASy Swiss-Prot
Match: Q4VZK6 (50S ribosomal protein L23, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl23-A PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 3.7e-35 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. ExPASy Swiss-Prot
Match: Q0ZIV5 (50S ribosomal protein L23, chloroplastic OS=Vitis vinifera OX=29760 GN=rpl23-A PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 3.7e-35 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. ExPASy Swiss-Prot
Match: A0A378 (50S ribosomal protein L23, chloroplastic OS=Coffea arabica OX=13443 GN=rpl23-A PE=3 SV=1) HSP 1 Score: 147.1 bits (370), Expect = 8.2e-35 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. ExPASy Swiss-Prot
Match: Q06R67 (50S ribosomal protein L23, chloroplastic OS=Jasminum nudiflorum OX=126431 GN=rpl23-A PE=3 SV=1) HSP 1 Score: 146.7 bits (369), Expect = 1.1e-34 Identity = 68/74 (91.89%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. ExPASy Swiss-Prot
Match: Q0PUX7 (50S ribosomal protein L23, chloroplastic OS=Fragaria ananassa OX=3747 GN=rpl23 PE=3 SV=1) HSP 1 Score: 146.4 bits (368), Expect = 1.4e-34 Identity = 68/74 (91.89%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of IVF0003111 vs. ExPASy TrEMBL
Match: A0A2H4V4Q8 (Ribosomal protein subunit L23 OS=Olea europaea subsp. guanchica OX=158384 GN=rpl23 PE=3 SV=1) HSP 1 Score: 148.7 bits (374), Expect = 1.0e-32 Identity = 70/74 (94.59%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. ExPASy TrEMBL
Match: F5C018 (50S ribosomal protein L23, chloroplastic OS=Asclepias syriaca OX=48545 GN=rpl23 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 1.4e-32 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. ExPASy TrEMBL
Match: A0A2L0VCX1 (50S ribosomal protein L23 OS=Fraxinus chiisanensis OX=490838 GN=rpl23 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 1.4e-32 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. ExPASy TrEMBL
Match: A0A4D5Y878 (50S ribosomal protein L23, chloroplastic OS=Fraxinus quadrangulata OX=56032 GN=rpl23 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 1.4e-32 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. ExPASy TrEMBL
Match: A0A6B7GR59 (50S ribosomal protein L23, chloroplastic OS=Fraxinus sieboldiana OX=490850 GN=rpl23 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 1.4e-32 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. NCBI nr
Match: WP_189908500.1 (50S ribosomal protein L23, partial [Streptomyces spiralis]) HSP 1 Score: 146 bits (369), Expect = 4.58e-44 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. NCBI nr
Match: RXV70581.1 (50S ribosomal protein L23, partial [bacterium 1XD8-92]) HSP 1 Score: 146 bits (369), Expect = 4.99e-44 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. NCBI nr
Match: AUB30625.1 (ribosomal protein subunit L23 [Olea europaea subsp. guanchica]) HSP 1 Score: 147 bits (370), Expect = 5.48e-44 Identity = 70/74 (94.59%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. NCBI nr
Match: ALI90961.1 (Rpl23, partial [Apodytes dimidiata] >ALI90985.1 Rpl23, partial [Nama carnosa] >ALI91003.1 Rpl23, partial [Rhaphiostylis ferruginea]) HSP 1 Score: 146 bits (369), Expect = 7.11e-44 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. NCBI nr
Match: YP_009707931.1 (ribosomal protein L23 [Begonia pulchrifolia] >YP_009707953.1 ribosomal protein L23 [Begonia pulchrifolia] >YP_009733685.1 ribosomal protein L23 [Begonia guangxiensis] >YP_009733704.1 ribosomal protein L23 [Begonia guangxiensis] >YP_009775176.1 ribosomal protein L23 [Begonia versicolor] >YP_009775195.1 ribosomal protein L23 [Begonia versicolor] >YP_010117494.1 ribosomal protein L23 [Begonia coptidifolia] >YP_010117557.1 ribosomal protein L23 [Begonia coptidifolia] >QEU52793.1 ribosomal protein L23 [Begonia pulchrifolia] >QEU52794.1 ribosomal protein L23 [Begonia pulchrifolia] >QHV34433.1 ribosomal protein L23 [Begonia guangxiensis] >QHV34454.1 ribosomal protein L23 [Begonia guangxiensis] >QJA15232.1 ribosomal protein L23 [Begonia versicolor]) HSP 1 Score: 146 bits (369), Expect = 7.78e-44 Identity = 69/74 (93.24%), Postives = 72/74 (97.30%), Query Frame = 0
BLAST of IVF0003111 vs. TAIR 10
Match: ATCG00840.1 (ribosomal protein L23.1 ) HSP 1 Score: 141.4 bits (355), Expect = 3.2e-34 Identity = 66/74 (89.19%), Postives = 71/74 (95.95%), Query Frame = 0
BLAST of IVF0003111 vs. TAIR 10
Match: ATCG01300.1 (ribosomal protein L23 ) HSP 1 Score: 141.4 bits (355), Expect = 3.2e-34 Identity = 66/74 (89.19%), Postives = 71/74 (95.95%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|