IVF0003033 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideexonCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGTCAGATTCAGTACTCTGAGAAGTACTTCGACGACATTTATGAGTACAGGTATTGTGTTCTTACTCTCAGTTTCCAACTCCATTGTTACTCGCAGTCTTGAAGAATTGTTTGGATTTGGAAGCGTTCGTTCTTTGTCTTCAATGTCTATATGGATTGATTGGTGCAGGCACGTGGTTCTCCCACCCGAAGTCGCAAAGTTGCTTCCTAAGAATCGTCTGCTCTCGGAAGTAAGCGATTTTGTTTTCTTAGTTTCAAATTTATGTGTTTCGATTTTGATACGAACGGAAGTGTTCTCTTATTGATTAGGAAGAAACTTAGTTCAGTAGTTGAATTCTTATATCAGGTTTAGGTATCACTCTTGAGACCTTAAGAAATAGTTATTATTCCGTGGACAGTTTTTTCCCCTATTTTTAATCTTTTATATTTTCATATGGTCTTGATATTCTCTCTTTGATTTGGCTGATGGTTGCATGAAGTTGTAACCATGCTTATGAGTATTTCGCATAGAAGTTGTATGAAAAAGGATTGAGAATCCAGGGCTTATGACTTATTCATTAGACTAGACCCCTTCTGGTTTTCCAATCTTGCAATTCTCTCTATGCAATTAGTGAGCAATGGACGCTTCTGTTGGGCATAAGCATAGGAGCATTATCATACCATCGATGTCTTATGAGTTTCTTGGCTTTCGTCTTGAACTCAAGTTATCATTGTTCGAAACAAAAGGATGCTTTTCAAATCTGTTTTACTACTCGTTTCATGGAAGCATTTTGTTATACTTTTAGCCCTTTAATCTTATGTGCAGAATGAATGGCGTGCAATTGGAGTTCAGCAGAGTCGTGGGTGGGTGCACTATGCTATTCATCGTCCCGAACCGCATATCATGCTATTCAGGAGGCCCCTGAACTACCAACAGCAGCAGGAGAATCGCACTCAACAAAATGCGCTTGCTGCTAAATGA ATGGGTCAGATTCAGTACTCTGAGAAGTACTTCGACGACATTTATGAGTACAGGCACGTGGTTCTCCCACCCGAAGTCGCAAAGTTGCTTCCTAAGAATCGTCTGCTCTCGGAAAATGAATGGCGTGCAATTGGAGTTCAGCAGAGTCGTGGGTGGGTGCACTATGCTATTCATCGTCCCGAACCGCATATCATGCTATTCAGGAGGCCCCTGAACTACCAACAGCAGCAGGAGAATCGCACTCAACAAAATGCGCTTGCTGCTAAATGA ATGGGTCAGATTCAGTACTCTGAGAAGTACTTCGACGACATTTATGAGTACAGGCACGTGGTTCTCCCACCCGAAGTCGCAAAGTTGCTTCCTAAGAATCGTCTGCTCTCGGAAAATGAATGGCGTGCAATTGGAGTTCAGCAGAGTCGTGGGTGGGTGCACTATGCTATTCATCGTCCCGAACCGCATATCATGCTATTCAGGAGGCCCCTGAACTACCAACAGCAGCAGGAGAATCGCACTCAACAAAATGCGCTTGCTGCTAAATGA MGQIQYSEKYFDDIYEYRHVVLPPEVAKLLPKNRLLSENEWRAIGVQQSRGWVHYAIHRPEPHIMLFRRPLNYQQQQENRTQQNALAAK Homology
BLAST of IVF0003033 vs. ExPASy Swiss-Prot
Match: O23249 (Cyclin-dependent kinases regulatory subunit 1 OS=Arabidopsis thaliana OX=3702 GN=CKS1 PE=1 SV=1) HSP 1 Score: 168.3 bits (425), Expect = 3.9e-41 Identity = 77/82 (93.90%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of IVF0003033 vs. ExPASy Swiss-Prot
Match: A2XCH8 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. indica OX=39946 GN=CKS1 PE=2 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 4.3e-40 Identity = 76/78 (97.44%), Postives = 77/78 (98.72%), Query Frame = 0
BLAST of IVF0003033 vs. ExPASy Swiss-Prot
Match: Q6PS57 (Cyclin-dependent kinases regulatory subunit 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CKS1 PE=2 SV=1) HSP 1 Score: 164.9 bits (416), Expect = 4.3e-40 Identity = 76/78 (97.44%), Postives = 77/78 (98.72%), Query Frame = 0
BLAST of IVF0003033 vs. ExPASy Swiss-Prot
Match: Q9SJJ5 (Cyclin-dependent kinases regulatory subunit 2 OS=Arabidopsis thaliana OX=3702 GN=CKS2 PE=1 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 1.2e-37 Identity = 70/78 (89.74%), Postives = 76/78 (97.44%), Query Frame = 0
BLAST of IVF0003033 vs. ExPASy Swiss-Prot
Match: P55933 (Probable cyclin-dependent kinases regulatory subunit OS=Physarum polycephalum OX=5791 PE=1 SV=1) HSP 1 Score: 125.6 bits (314), Expect = 2.9e-28 Identity = 53/66 (80.30%), Postives = 62/66 (93.94%), Query Frame = 0
BLAST of IVF0003033 vs. ExPASy TrEMBL
Match: A0A5D3DKQ6 (Cyclin-dependent kinases regulatory subunit OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1754G00180 PE=3 SV=1) HSP 1 Score: 188.0 bits (476), Expect = 1.8e-44 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 0
BLAST of IVF0003033 vs. ExPASy TrEMBL
Match: A0A1S3CNU7 (Cyclin-dependent kinases regulatory subunit OS=Cucumis melo OX=3656 GN=LOC103503041 PE=3 SV=1) HSP 1 Score: 188.0 bits (476), Expect = 1.8e-44 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 0
BLAST of IVF0003033 vs. ExPASy TrEMBL
Match: A0A2I4GKZ4 (Cyclin-dependent kinases regulatory subunit OS=Juglans regia OX=51240 GN=LOC109016561 PE=3 SV=1) HSP 1 Score: 179.5 bits (454), Expect = 6.2e-42 Identity = 84/87 (96.55%), Postives = 85/87 (97.70%), Query Frame = 0
BLAST of IVF0003033 vs. ExPASy TrEMBL
Match: A0A6J1K8L9 (Cyclin-dependent kinases regulatory subunit OS=Cucurbita maxima OX=3661 GN=LOC111491633 PE=3 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 1.1e-41 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of IVF0003033 vs. ExPASy TrEMBL
Match: A0A6J1H322 (Cyclin-dependent kinases regulatory subunit OS=Cucurbita moschata OX=3662 GN=LOC111459235 PE=3 SV=1) HSP 1 Score: 178.7 bits (452), Expect = 1.1e-41 Identity = 84/89 (94.38%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of IVF0003033 vs. NCBI nr
Match: XP_008465423.1 (PREDICTED: cyclin-dependent kinases regulatory subunit 1-like [Cucumis melo] >KAA0037300.1 cyclin-dependent kinases regulatory subunit 1-like [Cucumis melo var. makuwa] >TYK24184.1 cyclin-dependent kinases regulatory subunit 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 185 bits (470), Expect = 4.06e-59 Identity = 89/89 (100.00%), Postives = 89/89 (100.00%), Query Frame = 0
BLAST of IVF0003033 vs. NCBI nr
Match: XP_038902899.1 (cyclin-dependent kinases regulatory subunit 1-like [Benincasa hispida]) HSP 1 Score: 179 bits (454), Expect = 1.12e-56 Identity = 86/89 (96.63%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of IVF0003033 vs. NCBI nr
Match: XP_018854502.1 (cyclin-dependent kinases regulatory subunit 1-like [Juglans regia] >XP_040991781.1 cyclin-dependent kinases regulatory subunit 1-like [Juglans microcarpa x Juglans regia] >XP_042955613.1 cyclin-dependent kinases regulatory subunit 1 [Carya illinoinensis] >XP_042955614.1 cyclin-dependent kinases regulatory subunit 1 [Carya illinoinensis] >KAG2674589.1 hypothetical protein I3760_13G143300 [Carya illinoinensis] >KAG6632237.1 hypothetical protein CIPAW_13G144800 [Carya illinoinensis] >KAG6682493.1 hypothetical protein I3842_13G144400 [Carya illinoinensis] >KAG7950678.1 hypothetical protein I3843_13G127600 [Carya illinoinensis]) HSP 1 Score: 177 bits (449), Expect = 6.31e-56 Identity = 84/87 (96.55%), Postives = 85/87 (97.70%), Query Frame = 0
BLAST of IVF0003033 vs. NCBI nr
Match: XP_028756892.1 (cyclin-dependent kinases regulatory subunit 1 [Prosopis alba] >XP_028788395.1 cyclin-dependent kinases regulatory subunit 1 [Prosopis alba]) HSP 1 Score: 177 bits (448), Expect = 9.24e-56 Identity = 84/89 (94.38%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of IVF0003033 vs. NCBI nr
Match: XP_011657043.1 (LOW QUALITY PROTEIN: cyclin-dependent kinases regulatory subunit 1 [Cucumis sativus]) HSP 1 Score: 177 bits (448), Expect = 9.24e-56 Identity = 85/89 (95.51%), Postives = 85/89 (95.51%), Query Frame = 0
BLAST of IVF0003033 vs. TAIR 10
Match: AT2G27960.1 (cyclin-dependent kinase-subunit 1 ) HSP 1 Score: 168.3 bits (425), Expect = 2.8e-42 Identity = 77/82 (93.90%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of IVF0003033 vs. TAIR 10
Match: AT2G27970.1 (CDK-subunit 2 ) HSP 1 Score: 156.8 bits (395), Expect = 8.3e-39 Identity = 70/78 (89.74%), Postives = 76/78 (97.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|