![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
IVF0002562 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTCCGAGCGAGCTTAAAGATTTGGAGGTGCAATTACAAGAACTGGTTGACAAGGGATACATCAGGCCTAGTGTATCGCCTTGGGGAGCACCAATGCTATTTGTGAAAAGCATAGATGGTACTCTTAGATTATGTATTGATTATAGACAGTTAAACAAGGTTACAATATGTAACAAGTATCCTTTACCACACATCGATGACTTATTTGATCAGCTAAGAGGAACAACATTGTTCTCTAAGATTGACTTAAGATCAGGATACCACCAATTGAAGGTTAAAGAATCAGATATTCCTAAGACAACATTCAGAACGAGGTATGGGCACTATGAGTTCTGA ATGGCTCCGAGCGAGCTTAAAGATTTGGAGGTGCAATTACAAGAACTGGTTGACAAGGGATACATCAGGCCTAGTGTATCGCCTTGGGGAGCACCAATGCTATTTGTGAAAAGCATAGATGGTACTCTTAGATTATGTATTGATTATAGACAGTTAAACAAGGTTACAATATGTAACAAGTATCCTTTACCACACATCGATGACTTATTTGATCAGCTAAGAGGAACAACATTGTTCTCTAAGATTGACTTAAGATCAGGATACCACCAATTGAAGGTTAAAGAATCAGATATTCCTAAGACAACATTCAGAACGAGGTATGGGCACTATGAGTTCTGA ATGGCTCCGAGCGAGCTTAAAGATTTGGAGGTGCAATTACAAGAACTGGTTGACAAGGGATACATCAGGCCTAGTGTATCGCCTTGGGGAGCACCAATGCTATTTGTGAAAAGCATAGATGGTACTCTTAGATTATGTATTGATTATAGACAGTTAAACAAGGTTACAATATGTAACAAGTATCCTTTACCACACATCGATGACTTATTTGATCAGCTAAGAGGAACAACATTGTTCTCTAAGATTGACTTAAGATCAGGATACCACCAATTGAAGGTTAAAGAATCAGATATTCCTAAGACAACATTCAGAACGAGGTATGGGCACTATGAGTTCTGA MAPSELKDLEVQLQELVDKGYIRPSVSPWGAPMLFVKSIDGTLRLCIDYRQLNKVTICNKYPLPHIDDLFDQLRGTTLFSKIDLRSGYHQLKVKESDIPKTTFRTRYGHYEF Homology
BLAST of IVF0002562 vs. ExPASy Swiss-Prot
Match: Q99315 (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3) HSP 1 Score: 104.8 bits (260), Expect = 6.6e-22 Identity = 46/100 (46.00%), Postives = 66/100 (66.00%), Query Frame = 0
BLAST of IVF0002562 vs. ExPASy Swiss-Prot
Match: Q7LHG5 (Transposon Ty3-I Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-I PE=1 SV=2) HSP 1 Score: 104.8 bits (260), Expect = 6.6e-22 Identity = 46/100 (46.00%), Postives = 66/100 (66.00%), Query Frame = 0
BLAST of IVF0002562 vs. ExPASy Swiss-Prot
Match: P31843 (RNA-directed DNA polymerase homolog OS=Oenothera berteroana OX=3950 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 1.6e-20 Identity = 44/71 (61.97%), Postives = 56/71 (78.87%), Query Frame = 0
BLAST of IVF0002562 vs. ExPASy Swiss-Prot
Match: P20825 (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1) HSP 1 Score: 96.3 bits (238), Expect = 2.4e-19 Identity = 45/110 (40.91%), Postives = 74/110 (67.27%), Query Frame = 0
BLAST of IVF0002562 vs. ExPASy Swiss-Prot
Match: P10394 (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 4.0e-19 Identity = 46/115 (40.00%), Postives = 70/115 (60.87%), Query Frame = 0
BLAST of IVF0002562 vs. ExPASy TrEMBL
Match: A0A5A7VEM3 (Putative Retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold638G00410 PE=4 SV=1) HSP 1 Score: 225.7 bits (574), Expect = 9.5e-56 Identity = 107/111 (96.40%), Postives = 108/111 (97.30%), Query Frame = 0
BLAST of IVF0002562 vs. ExPASy TrEMBL
Match: A0A5D3E0X2 (DNA/RNA polymerases superfamily protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold1212G00480 PE=4 SV=1) HSP 1 Score: 225.7 bits (574), Expect = 9.5e-56 Identity = 107/111 (96.40%), Postives = 108/111 (97.30%), Query Frame = 0
BLAST of IVF0002562 vs. ExPASy TrEMBL
Match: A0A5D3DHC6 (Reverse transcriptase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold386G00380 PE=4 SV=1) HSP 1 Score: 216.5 bits (550), Expect = 5.8e-53 Identity = 101/112 (90.18%), Postives = 107/112 (95.54%), Query Frame = 0
BLAST of IVF0002562 vs. ExPASy TrEMBL
Match: A0A5A7V8M7 (Putative Retrotransposon protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold679G00210 PE=4 SV=1) HSP 1 Score: 214.5 bits (545), Expect = 2.2e-52 Identity = 101/112 (90.18%), Postives = 105/112 (93.75%), Query Frame = 0
BLAST of IVF0002562 vs. ExPASy TrEMBL
Match: A0A5A7SR31 (DNA/RNA polymerases superfamily protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold239G001000 PE=4 SV=1) HSP 1 Score: 214.5 bits (545), Expect = 2.2e-52 Identity = 100/112 (89.29%), Postives = 106/112 (94.64%), Query Frame = 0
BLAST of IVF0002562 vs. NCBI nr
Match: TYK29281.1 (DNA/RNA polymerases superfamily protein [Cucumis melo var. makuwa]) HSP 1 Score: 223 bits (567), Expect = 4.64e-66 Identity = 107/111 (96.40%), Postives = 108/111 (97.30%), Query Frame = 0
BLAST of IVF0002562 vs. NCBI nr
Match: KAA0065537.1 (putative Retrotransposon protein [Cucumis melo var. makuwa]) HSP 1 Score: 223 bits (567), Expect = 9.74e-66 Identity = 107/111 (96.40%), Postives = 108/111 (97.30%), Query Frame = 0
BLAST of IVF0002562 vs. NCBI nr
Match: WP_217833159.1 (hypothetical protein, partial [Synechococcus sp. PCC 7002]) HSP 1 Score: 213 bits (541), Expect = 2.11e-65 Identity = 98/112 (87.50%), Postives = 106/112 (94.64%), Query Frame = 0
BLAST of IVF0002562 vs. NCBI nr
Match: PKI41747.1 (hypothetical protein CRG98_037862 [Punica granatum]) HSP 1 Score: 202 bits (514), Expect = 7.06e-65 Identity = 91/112 (81.25%), Postives = 105/112 (93.75%), Query Frame = 0
BLAST of IVF0002562 vs. NCBI nr
Match: PPZ24847.1 (hypothetical protein C5P36_26655, partial [Escherichia coli]) HSP 1 Score: 199 bits (507), Expect = 1.43e-63 Identity = 90/112 (80.36%), Postives = 104/112 (92.86%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|