IVF0001480 (gene) Melon (IVF77) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTGTGTTTTTTTATTACTATCAAAAGGGCTTGCTCCAAAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGCTGTCTCGATTAGAAAGCATTTGGAAAGGCATAGGAAGGACAAAGACTCCAAGTTCAGGTTGATTCTTGTTGATTCTTGA ATGTGTGTTTTTTTATTACTATCAAAAGGGCTTGCTCCAAAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGCTGTCTCGATTAGAAAGCATTTGGAAAGGCATAGGAAGGACAAAGACTCCAAGTTCAGGTTGATTCTTGTTGATTCTTGA ATGTGTGTTTTTTTATTACTATCAAAAGGGCTTGCTCCAAAGATTCCTGAGGATCTTTACCATTTGATTAAGAAGGCTGTCTCGATTAGAAAGCATTTGGAAAGGCATAGGAAGGACAAAGACTCCAAGTTCAGGTTGATTCTTGTTGATTCTTGA MCVFLLLSKGLAPKIPEDLYHLIKKAVSIRKHLERHRKDKDSKFRLILVDS Homology
BLAST of IVF0001480 vs. ExPASy Swiss-Prot
Match: P62302 (40S ribosomal protein S13 OS=Glycine max OX=3847 GN=RPS13 PE=2 SV=1) HSP 1 Score: 81.6 bits (200), Expect = 2.7e-15 Identity = 40/47 (85.11%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0001480 vs. ExPASy Swiss-Prot
Match: P62299 (40S ribosomal protein S13 OS=Brugia pahangi OX=6280 GN=RPS13 PE=2 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 4.7e-15 Identity = 39/49 (79.59%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of IVF0001480 vs. ExPASy Swiss-Prot
Match: P47772 (40S ribosomal protein S13 OS=Ictalurus punctatus OX=7998 GN=rps13 PE=2 SV=3) HSP 1 Score: 80.9 bits (198), Expect = 4.7e-15 Identity = 38/47 (80.85%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0001480 vs. ExPASy Swiss-Prot
Match: P46298 (40S ribosomal protein S13 OS=Pisum sativum OX=3888 GN=RPS13 PE=2 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 4.7e-15 Identity = 40/47 (85.11%), Postives = 44/47 (93.62%), Query Frame = 0
BLAST of IVF0001480 vs. ExPASy Swiss-Prot
Match: P62300 (40S ribosomal protein S13 OS=Wuchereria bancrofti OX=6293 GN=RPS13 PE=3 SV=2) HSP 1 Score: 80.9 bits (198), Expect = 4.7e-15 Identity = 39/49 (79.59%), Postives = 47/49 (95.92%), Query Frame = 0
BLAST of IVF0001480 vs. ExPASy TrEMBL
Match: A0A5A7ULW0 (40S ribosomal protein S13-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold431G00100 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 1.8e-14 Identity = 43/47 (91.49%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0001480 vs. ExPASy TrEMBL
Match: A0A0L8G2L9 (40S ribosomal protein S13 OS=Octopus bimaculoides OX=37653 GN=OCBIM_22001297mg PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 2.0e-13 Identity = 39/47 (82.98%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of IVF0001480 vs. ExPASy TrEMBL
Match: A8UAD8 (40S ribosomal protein S13 OS=Barentsia elongata OX=478378 PE=2 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 2.0e-13 Identity = 41/47 (87.23%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of IVF0001480 vs. ExPASy TrEMBL
Match: A0A6P7TQ93 (40S ribosomal protein S13 OS=Octopus vulgaris OX=6645 GN=LOC115225287 PE=3 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 2.0e-13 Identity = 39/47 (82.98%), Postives = 46/47 (97.87%), Query Frame = 0
BLAST of IVF0001480 vs. ExPASy TrEMBL
Match: A0A5A7TK12 (40S ribosomal protein S13 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold320G00500 PE=4 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 2.0e-13 Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of IVF0001480 vs. NCBI nr
Match: KAA0056184.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 85.5 bits (210), Expect = 1.11e-18 Identity = 43/47 (91.49%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0001480 vs. NCBI nr
Match: KAA0043612.1 (40S ribosomal protein S13 [Cucumis melo var. makuwa]) HSP 1 Score: 82.4 bits (202), Expect = 1.21e-18 Identity = 43/53 (81.13%), Postives = 49/53 (92.45%), Query Frame = 0
BLAST of IVF0001480 vs. NCBI nr
Match: KAA0049888.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 81.3 bits (199), Expect = 1.55e-18 Identity = 41/47 (87.23%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0001480 vs. NCBI nr
Match: TYK07625.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa] >TYK14810.1 40S ribosomal protein S13-like [Cucumis melo var. makuwa] >TYK15131.1 40S ribosomal protein S13-like [Cucumis melo var. makuwa] >TYK22659.1 40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 81.3 bits (199), Expect = 1.55e-18 Identity = 41/47 (87.23%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0001480 vs. NCBI nr
Match: KAA0046917.1 (40S ribosomal protein S13-like [Cucumis melo var. makuwa]) HSP 1 Score: 81.3 bits (199), Expect = 1.55e-18 Identity = 41/47 (87.23%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0001480 vs. TAIR 10
Match: AT3G60770.1 (Ribosomal protein S13/S15 ) HSP 1 Score: 80.5 bits (197), Expect = 4.3e-16 Identity = 39/47 (82.98%), Postives = 45/47 (95.74%), Query Frame = 0
BLAST of IVF0001480 vs. TAIR 10
Match: AT4G00100.1 (ribosomal protein S13A ) HSP 1 Score: 80.5 bits (197), Expect = 4.3e-16 Identity = 39/47 (82.98%), Postives = 45/47 (95.74%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Melon (IVF77) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|