HG10022869 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGACTGGCTAGGGCAAAAGCTAGCGGAGCAGCTGATGCAGATTATGTTGGTTGCATTTGCCGTTGTGGGCTTTTCGACTGGCTATGTTATGGGATCATTTCAAATGATGATCTTGGTTTACGCTGCTGCTGTGTTTCTCACCACATTAATCACTGTTCCGAATTGGCCTTTCTTCAATCGCCACCCGCTCAATTGGTTGGATCCTTGTGTGGTTGATAAATACCCTAAGCCGCAACCGCAGGAGCCTGTGGTTTTGAAGAAGAAACCTGCTAAGAAGTAG ATGGACTGGCTAGGGCAAAAGCTAGCGGAGCAGCTGATGCAGATTATGTTGGTTGCATTTGCCGTTGTGGGCTTTTCGACTGGCTATGTTATGGGATCATTTCAAATGATGATCTTGGTTTACGCTGCTGCTGTGTTTCTCACCACATTAATCACTGTTCCGAATTGGCCTTTCTTCAATCGCCACCCGCTCAATTGGTTGGATCCTTGTGTGGTTGATAAATACCCTAAGCCGCAACCGCAGGAGCCTGTGGTTTTGAAGAAGAAACCTGCTAAGAAGTAG ATGGACTGGCTAGGGCAAAAGCTAGCGGAGCAGCTGATGCAGATTATGTTGGTTGCATTTGCCGTTGTGGGCTTTTCGACTGGCTATGTTATGGGATCATTTCAAATGATGATCTTGGTTTACGCTGCTGCTGTGTTTCTCACCACATTAATCACTGTTCCGAATTGGCCTTTCTTCAATCGCCACCCGCTCAATTGGTTGGATCCTTGTGTGGTTGATAAATACCCTAAGCCGCAACCGCAGGAGCCTGTGGTTTTGAAGAAGAAACCTGCTAAGAAGTAG MDWLGQKLAEQLMQIMLVAFAVVGFSTGYVMGSFQMMILVYAAAVFLTTLITVPNWPFFNRHPLNWLDPCVVDKYPKPQPQEPVVLKKKPAKK Homology
BLAST of HG10022869 vs. NCBI nr
Match: XP_004135313.1 (probable signal peptidase complex subunit 1 [Cucumis sativus] >XP_031741214.1 probable signal peptidase complex subunit 1 [Cucumis sativus]) HSP 1 Score: 164.1 bits (414), Expect = 5.8e-37 Identity = 80/93 (86.02%), Postives = 85/93 (91.40%), Query Frame = 0
BLAST of HG10022869 vs. NCBI nr
Match: KGN51679.1 (hypothetical protein Csa_009252 [Cucumis sativus]) HSP 1 Score: 164.1 bits (414), Expect = 5.8e-37 Identity = 80/93 (86.02%), Postives = 85/93 (91.40%), Query Frame = 0
BLAST of HG10022869 vs. NCBI nr
Match: XP_008446045.1 (PREDICTED: probable signal peptidase complex subunit 1 [Cucumis melo] >XP_008446046.1 PREDICTED: probable signal peptidase complex subunit 1 [Cucumis melo] >XP_016900289.1 PREDICTED: probable signal peptidase complex subunit 1 [Cucumis melo] >KAA0034201.1 putative signal peptidase complex subunit 1 [Cucumis melo var. makuwa] >TYK15719.1 putative signal peptidase complex subunit 1 [Cucumis melo var. makuwa]) HSP 1 Score: 163.7 bits (413), Expect = 7.6e-37 Identity = 81/93 (87.10%), Postives = 84/93 (90.32%), Query Frame = 0
BLAST of HG10022869 vs. NCBI nr
Match: XP_038882954.1 (probable signal peptidase complex subunit 1 [Benincasa hispida]) HSP 1 Score: 159.8 bits (403), Expect = 1.1e-35 Identity = 79/93 (84.95%), Postives = 83/93 (89.25%), Query Frame = 0
BLAST of HG10022869 vs. NCBI nr
Match: XP_023549840.1 (probable signal peptidase complex subunit 1 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 157.9 bits (398), Expect = 4.2e-35 Identity = 78/93 (83.87%), Postives = 82/93 (88.17%), Query Frame = 0
BLAST of HG10022869 vs. ExPASy Swiss-Prot
Match: Q944J0 (Probable signal peptidase complex subunit 1 OS=Arabidopsis thaliana OX=3702 GN=At2g22425 PE=3 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 2.5e-22 Identity = 55/93 (59.14%), Postives = 65/93 (69.89%), Query Frame = 0
BLAST of HG10022869 vs. ExPASy Swiss-Prot
Match: B0FWK4 (Signal peptidase complex subunit 1 OS=Sus scrofa OX=9823 GN=SPCS1 PE=3 SV=1) HSP 1 Score: 64.3 bits (155), Expect = 8.3e-10 Identity = 34/79 (43.04%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of HG10022869 vs. ExPASy Swiss-Prot
Match: Q3T134 (Signal peptidase complex subunit 1 OS=Bos taurus OX=9913 GN=SPCS1 PE=3 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.1e-09 Identity = 33/79 (41.77%), Postives = 46/79 (58.23%), Query Frame = 0
BLAST of HG10022869 vs. ExPASy Swiss-Prot
Match: Q9Y6A9 (Signal peptidase complex subunit 1 OS=Homo sapiens OX=9606 GN=SPCS1 PE=1 SV=5) HSP 1 Score: 63.9 bits (154), Expect = 1.1e-09 Identity = 30/67 (44.78%), Postives = 42/67 (62.69%), Query Frame = 0
BLAST of HG10022869 vs. ExPASy Swiss-Prot
Match: Q9D958 (Signal peptidase complex subunit 1 OS=Mus musculus OX=10090 GN=Spcs1 PE=2 SV=3) HSP 1 Score: 63.9 bits (154), Expect = 1.1e-09 Identity = 30/67 (44.78%), Postives = 42/67 (62.69%), Query Frame = 0
BLAST of HG10022869 vs. ExPASy TrEMBL
Match: A0A0A0KS09 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_5G589960 PE=3 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 2.8e-37 Identity = 80/93 (86.02%), Postives = 85/93 (91.40%), Query Frame = 0
BLAST of HG10022869 vs. ExPASy TrEMBL
Match: A0A1S3BET6 (probable signal peptidase complex subunit 1 OS=Cucumis melo OX=3656 GN=LOC103488895 PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 3.7e-37 Identity = 81/93 (87.10%), Postives = 84/93 (90.32%), Query Frame = 0
BLAST of HG10022869 vs. ExPASy TrEMBL
Match: A0A5D3CZV6 (Putative signal peptidase complex subunit 1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold35G002180 PE=3 SV=1) HSP 1 Score: 163.7 bits (413), Expect = 3.7e-37 Identity = 81/93 (87.10%), Postives = 84/93 (90.32%), Query Frame = 0
BLAST of HG10022869 vs. ExPASy TrEMBL
Match: A0A6J1KDF1 (probable signal peptidase complex subunit 1 OS=Cucurbita maxima OX=3661 GN=LOC111493339 PE=3 SV=1) HSP 1 Score: 157.9 bits (398), Expect = 2.0e-35 Identity = 78/93 (83.87%), Postives = 82/93 (88.17%), Query Frame = 0
BLAST of HG10022869 vs. ExPASy TrEMBL
Match: A0A6J1GX63 (probable signal peptidase complex subunit 1 OS=Cucurbita moschata OX=3662 GN=LOC111458355 PE=3 SV=1) HSP 1 Score: 156.4 bits (394), Expect = 5.9e-35 Identity = 77/93 (82.80%), Postives = 81/93 (87.10%), Query Frame = 0
BLAST of HG10022869 vs. TAIR 10
Match: AT4G40042.1 (Microsomal signal peptidase 12 kDa subunit (SPC12) ) HSP 1 Score: 110.9 bits (276), Expect = 5.5e-25 Identity = 57/93 (61.29%), Postives = 66/93 (70.97%), Query Frame = 0
BLAST of HG10022869 vs. TAIR 10
Match: AT2G22425.1 (Microsomal signal peptidase 12 kDa subunit (SPC12) ) HSP 1 Score: 105.9 bits (263), Expect = 1.8e-23 Identity = 55/93 (59.14%), Postives = 65/93 (69.89%), Query Frame = 0
BLAST of HG10022869 vs. TAIR 10
Match: AT2G22425.2 (Microsomal signal peptidase 12 kDa subunit (SPC12) ) HSP 1 Score: 105.9 bits (263), Expect = 1.8e-23 Identity = 55/93 (59.14%), Postives = 65/93 (69.89%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|