HG10022271 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCAGTCGCCGCCGCCGCCACTGTCGTCGATGGTGGTTCTCAGCCCCTGCGCCGCCTGTAAGATCCTCCGCCGGAGATGCGTCGATAATTGTGTTTTAGCGCCTTATTTTCCTCCCACTGAGCCTCTCAAATTCGCCGCCGTGCATAAAATATTCGGAGCCGGCAACGTCATCAAGTTCCTGCAGGTAAACACCAACGTCTAA ATGCAGTCGCCGCCGCCGCCACTGTCGTCGATGGTGGTTCTCAGCCCCTGCGCCGCCTGTAAGATCCTCCGCCGGAGATGCGTCGATAATTGTGTTTTAGCGCCTTATTTTCCTCCCACTGAGCCTCTCAAATTCGCCGCCGTGCATAAAATATTCGGAGCCGGCAACGTCATCAAGTTCCTGCAGGTAAACACCAACGTCTAA ATGCAGTCGCCGCCGCCGCCACTGTCGTCGATGGTGGTTCTCAGCCCCTGCGCCGCCTGTAAGATCCTCCGCCGGAGATGCGTCGATAATTGTGTTTTAGCGCCTTATTTTCCTCCCACTGAGCCTCTCAAATTCGCCGCCGTGCATAAAATATTCGGAGCCGGCAACGTCATCAAGTTCCTGCAGGTAAACACCAACGTCTAA MQSPPPPLSSMVVLSPCAACKILRRRCVDNCVLAPYFPPTEPLKFAAVHKIFGAGNVIKFLQVNTNV Homology
BLAST of HG10022271 vs. NCBI nr
Match: KAG7016272.1 (LOB domain-containing protein 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 121.3 bits (303), Expect = 3.1e-24 Identity = 57/62 (91.94%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of HG10022271 vs. NCBI nr
Match: KAG6578743.1 (LOB domain-containing protein 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 121.3 bits (303), Expect = 3.1e-24 Identity = 57/62 (91.94%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of HG10022271 vs. NCBI nr
Match: XP_022939142.1 (LOB domain-containing protein 1-like [Cucurbita moschata]) HSP 1 Score: 117.1 bits (292), Expect = 5.9e-23 Identity = 57/63 (90.48%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of HG10022271 vs. NCBI nr
Match: TYK05721.1 (LOB domain-containing protein 1-like [Cucumis melo var. makuwa]) HSP 1 Score: 113.6 bits (283), Expect = 6.5e-22 Identity = 52/62 (83.87%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of HG10022271 vs. NCBI nr
Match: XP_023551518.1 (LOB domain-containing protein 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 108.6 bits (270), Expect = 2.1e-20 Identity = 50/52 (96.15%), Postives = 51/52 (98.08%), Query Frame = 0
BLAST of HG10022271 vs. ExPASy Swiss-Prot
Match: Q9LQR0 (LOB domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=LBD1 PE=2 SV=1) HSP 1 Score: 102.8 bits (255), Expect = 1.5e-21 Identity = 45/60 (75.00%), Postives = 50/60 (83.33%), Query Frame = 0
BLAST of HG10022271 vs. ExPASy Swiss-Prot
Match: Q9SK08 (LOB domain-containing protein 11 OS=Arabidopsis thaliana OX=3702 GN=LBD11 PE=2 SV=2) HSP 1 Score: 98.6 bits (244), Expect = 2.8e-20 Identity = 46/66 (69.70%), Postives = 50/66 (75.76%), Query Frame = 0
BLAST of HG10022271 vs. ExPASy Swiss-Prot
Match: Q8LBW3 (LOB domain-containing protein 12 OS=Arabidopsis thaliana OX=3702 GN=LBD12 PE=1 SV=2) HSP 1 Score: 80.5 bits (197), Expect = 8.0e-15 Identity = 33/48 (68.75%), Postives = 39/48 (81.25%), Query Frame = 0
BLAST of HG10022271 vs. ExPASy Swiss-Prot
Match: Q9AT61 (LOB domain-containing protein 13 OS=Arabidopsis thaliana OX=3702 GN=LBD13 PE=1 SV=2) HSP 1 Score: 79.3 bits (194), Expect = 1.8e-14 Identity = 34/56 (60.71%), Postives = 43/56 (76.79%), Query Frame = 0
BLAST of HG10022271 vs. ExPASy Swiss-Prot
Match: Q8L8Q3 (LOB domain-containing protein 25 OS=Arabidopsis thaliana OX=3702 GN=LBD25 PE=2 SV=3) HSP 1 Score: 79.0 bits (193), Expect = 2.3e-14 Identity = 34/47 (72.34%), Postives = 37/47 (78.72%), Query Frame = 0
BLAST of HG10022271 vs. ExPASy TrEMBL
Match: A0A6J1FFZ7 (LOB domain-containing protein 1-like OS=Cucurbita moschata OX=3662 GN=LOC111445138 PE=3 SV=1) HSP 1 Score: 117.1 bits (292), Expect = 2.9e-23 Identity = 57/63 (90.48%), Postives = 58/63 (92.06%), Query Frame = 0
BLAST of HG10022271 vs. ExPASy TrEMBL
Match: A0A5D3C1A9 (LOB domain-containing protein 1-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold98G002050 PE=3 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 3.2e-22 Identity = 52/62 (83.87%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of HG10022271 vs. ExPASy TrEMBL
Match: A0A2G9G2A4 (LOB domain-containing protein OS=Handroanthus impetiginosus OX=429701 GN=CDL12_28234 PE=3 SV=1) HSP 1 Score: 108.2 bits (269), Expect = 1.3e-20 Identity = 47/60 (78.33%), Postives = 52/60 (86.67%), Query Frame = 0
BLAST of HG10022271 vs. ExPASy TrEMBL
Match: A0A6P3ZUA1 (LOB domain-containing protein 1-like OS=Ziziphus jujuba OX=326968 GN=LOC107413601 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 3.9e-20 Identity = 47/62 (75.81%), Postives = 53/62 (85.48%), Query Frame = 0
BLAST of HG10022271 vs. ExPASy TrEMBL
Match: A0A6P3ZFL3 (LOB domain-containing protein 1-like OS=Ziziphus jujuba OX=326968 GN=LOC107413678 PE=3 SV=1) HSP 1 Score: 106.7 bits (265), Expect = 3.9e-20 Identity = 47/62 (75.81%), Postives = 53/62 (85.48%), Query Frame = 0
BLAST of HG10022271 vs. TAIR 10
Match: AT1G07900.1 (LOB domain-containing protein 1 ) HSP 1 Score: 102.8 bits (255), Expect = 1.1e-22 Identity = 45/60 (75.00%), Postives = 50/60 (83.33%), Query Frame = 0
BLAST of HG10022271 vs. TAIR 10
Match: AT2G28500.1 (LOB domain-containing protein 11 ) HSP 1 Score: 98.6 bits (244), Expect = 2.0e-21 Identity = 46/66 (69.70%), Postives = 50/66 (75.76%), Query Frame = 0
BLAST of HG10022271 vs. TAIR 10
Match: AT2G30130.1 (Lateral organ boundaries (LOB) domain family protein ) HSP 1 Score: 80.5 bits (197), Expect = 5.7e-16 Identity = 33/48 (68.75%), Postives = 39/48 (81.25%), Query Frame = 0
BLAST of HG10022271 vs. TAIR 10
Match: AT2G30340.1 (LOB domain-containing protein 13 ) HSP 1 Score: 79.3 bits (194), Expect = 1.3e-15 Identity = 34/56 (60.71%), Postives = 43/56 (76.79%), Query Frame = 0
BLAST of HG10022271 vs. TAIR 10
Match: AT3G27650.1 (LOB domain-containing protein 25 ) HSP 1 Score: 79.0 bits (193), Expect = 1.7e-15 Identity = 34/47 (72.34%), Postives = 37/47 (78.72%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
|