![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
HG10021521 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTTCAATGAAAGGCATGTGCCTTTTGTTGGTCGTGATGATGGTGATTGTCAATGAAATGCAATCGGCGGAGGCAGTGAAATGCGAGCCAAATGAATTGAGACCATGTCTTTTGGCGTTCACAACGTCGGTGGAGCCATCTTCAACTTGTTGCAATAAAGTGAAGGAACACAGACCATGCTATTGTGGATACAAGAAATATCCAAAGATTCAACCCTATTTACAATATGATGCAACCAAAAGAATCATTTCTCAATGCGGAGTTGCCATCCCGACTTGCTAA ATGTTTTCAATGAAAGGCATGTGCCTTTTGTTGGTCGTGATGATGGTGATTGTCAATGAAATGCAATCGGCGGAGGCAGTGAAATGCGAGCCAAATGAATTGAGACCATGTCTTTTGGCGTTCACAACGTCGGTGGAGCCATCTTCAACTTGTTGCAATAAAGTGAAGGAACACAGACCATGCTATTGTGGATACAAGAAATATCCAAAGATTCAACCCTATTTACAATATGATGCAACCAAAAGAATCATTTCTCAATGCGGAGTTGCCATCCCGACTTGCTAA ATGTTTTCAATGAAAGGCATGTGCCTTTTGTTGGTCGTGATGATGGTGATTGTCAATGAAATGCAATCGGCGGAGGCAGTGAAATGCGAGCCAAATGAATTGAGACCATGTCTTTTGGCGTTCACAACGTCGGTGGAGCCATCTTCAACTTGTTGCAATAAAGTGAAGGAACACAGACCATGCTATTGTGGATACAAGAAATATCCAAAGATTCAACCCTATTTACAATATGATGCAACCAAAAGAATCATTTCTCAATGCGGAGTTGCCATCCCGACTTGCTAA MFSMKGMCLLLVVMMVIVNEMQSAEAVKCEPNELRPCLLAFTTSVEPSSTCCNKVKEHRPCYCGYKKYPKIQPYLQYDATKRIISQCGVAIPTC Homology
BLAST of HG10021521 vs. NCBI nr
Match: KGN66906.1 (hypothetical protein Csa_006987 [Cucumis sativus]) HSP 1 Score: 128.3 bits (321), Expect = 3.6e-26 Identity = 60/91 (65.93%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of HG10021521 vs. NCBI nr
Match: KAE8648143.1 (hypothetical protein Csa_023893, partial [Cucumis sativus]) HSP 1 Score: 105.9 bits (263), Expect = 1.9e-19 Identity = 44/83 (53.01%), Postives = 60/83 (72.29%), Query Frame = 0
BLAST of HG10021521 vs. NCBI nr
Match: KAE8648147.1 (hypothetical protein Csa_023900, partial [Cucumis sativus]) HSP 1 Score: 102.8 bits (255), Expect = 1.6e-18 Identity = 42/73 (57.53%), Postives = 54/73 (73.97%), Query Frame = 0
BLAST of HG10021521 vs. NCBI nr
Match: XP_022759945.1 (non-specific lipid-transfer protein 2-like [Durio zibethinus]) HSP 1 Score: 100.1 bits (248), Expect = 1.0e-17 Identity = 43/93 (46.24%), Postives = 63/93 (67.74%), Query Frame = 0
BLAST of HG10021521 vs. NCBI nr
Match: XP_022759947.1 (non-specific lipid-transfer protein 2-like [Durio zibethinus]) HSP 1 Score: 98.6 bits (244), Expect = 3.0e-17 Identity = 42/93 (45.16%), Postives = 62/93 (66.67%), Query Frame = 0
BLAST of HG10021521 vs. ExPASy Swiss-Prot
Match: Q43681 (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata OX=3917 PE=2 SV=1) HSP 1 Score: 84.3 bits (207), Expect = 7.8e-16 Identity = 37/91 (40.66%), Postives = 54/91 (59.34%), Query Frame = 0
BLAST of HG10021521 vs. ExPASy Swiss-Prot
Match: P86809 (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum OX=278110 PE=1 SV=1) HSP 1 Score: 71.6 bits (174), Expect = 5.2e-12 Identity = 28/63 (44.44%), Postives = 39/63 (61.90%), Query Frame = 0
BLAST of HG10021521 vs. ExPASy Swiss-Prot
Match: P82353 (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca OX=36596 PE=1 SV=1) HSP 1 Score: 70.9 bits (172), Expect = 8.9e-12 Identity = 27/68 (39.71%), Postives = 39/68 (57.35%), Query Frame = 0
BLAST of HG10021521 vs. ExPASy Swiss-Prot
Match: A2XBN5 (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica OX=39946 GN=LTP-2 PE=3 SV=2) HSP 1 Score: 54.3 bits (129), Expect = 8.6e-07 Identity = 24/88 (27.27%), Postives = 42/88 (47.73%), Query Frame = 0
BLAST of HG10021521 vs. ExPASy Swiss-Prot
Match: Q10ST8 (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=LTP-2 PE=1 SV=1) HSP 1 Score: 53.5 bits (127), Expect = 1.5e-06 Identity = 24/88 (27.27%), Postives = 42/88 (47.73%), Query Frame = 0
BLAST of HG10021521 vs. ExPASy TrEMBL
Match: A0A0A0M3W7 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G711160 PE=4 SV=1) HSP 1 Score: 128.3 bits (321), Expect = 1.7e-26 Identity = 60/91 (65.93%), Postives = 72/91 (79.12%), Query Frame = 0
BLAST of HG10021521 vs. ExPASy TrEMBL
Match: A0A6P6A5B6 (non-specific lipid-transfer protein 2-like OS=Durio zibethinus OX=66656 GN=LOC111306313 PE=4 SV=1) HSP 1 Score: 100.1 bits (248), Expect = 5.1e-18 Identity = 43/93 (46.24%), Postives = 63/93 (67.74%), Query Frame = 0
BLAST of HG10021521 vs. ExPASy TrEMBL
Match: A0A6P6A579 (non-specific lipid-transfer protein 2-like OS=Durio zibethinus OX=66656 GN=LOC111306314 PE=4 SV=1) HSP 1 Score: 98.6 bits (244), Expect = 1.5e-17 Identity = 42/93 (45.16%), Postives = 62/93 (66.67%), Query Frame = 0
BLAST of HG10021521 vs. ExPASy TrEMBL
Match: I1N5L5 (AAI domain-containing protein OS=Glycine max OX=3847 GN=GLYMA_19G002300 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 4.3e-17 Identity = 47/97 (48.45%), Postives = 60/97 (61.86%), Query Frame = 0
BLAST of HG10021521 vs. ExPASy TrEMBL
Match: A0A2Z6NR57 (AAI domain-containing protein OS=Trifolium subterraneum OX=3900 GN=TSUD_180120 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 4.3e-17 Identity = 44/94 (46.81%), Postives = 60/94 (63.83%), Query Frame = 0
BLAST of HG10021521 vs. TAIR 10
Match: AT3G18280.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 73.9 bits (180), Expect = 7.5e-14 Identity = 34/92 (36.96%), Postives = 54/92 (58.70%), Query Frame = 0
BLAST of HG10021521 vs. TAIR 10
Match: AT1G48750.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 67.8 bits (164), Expect = 5.4e-12 Identity = 28/94 (29.79%), Postives = 51/94 (54.26%), Query Frame = 0
BLAST of HG10021521 vs. TAIR 10
Match: AT1G66850.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 66.6 bits (161), Expect = 1.2e-11 Identity = 33/102 (32.35%), Postives = 51/102 (50.00%), Query Frame = 0
BLAST of HG10021521 vs. TAIR 10
Match: AT5G38170.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 65.9 bits (159), Expect = 2.0e-11 Identity = 27/68 (39.71%), Postives = 38/68 (55.88%), Query Frame = 0
BLAST of HG10021521 vs. TAIR 10
Match: AT5G38195.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 65.5 bits (158), Expect = 2.7e-11 Identity = 29/95 (30.53%), Postives = 52/95 (54.74%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|