HG10020972 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGCCGTAGATTCAGTCGTTGATCCTCTCAGAGAGTTCGCTAAGGACAGCGTTCGTCTCGTTAAGAGATGTCATAAACCCGATCGCAAGGGTATGTTTCTTCCTTTCACATTATATTGCATAGATCTGATTCAATCGAGGTCTTAGATTTTTGTTTTCCCTTTCAATTTGACTTAATTCAACGTTTTTCTGGTGTAGAATTCACCAAGGTTGCCGTTCGTACCGCTATCGGCTTCGTTGTGATGGGATTTGTAGGGTTCTTTGTCAAGCTAATCTTCATTCCGATCAACAACATCATCGTTGGATCTGGTTAG ATGGATGCCGTAGATTCAGTCGTTGATCCTCTCAGAGAGTTCGCTAAGGACAGCGTTCGTCTCGTTAAGAGATGTCATAAACCCGATCGCAAGGAATTCACCAAGGTTGCCGTTCGTACCGCTATCGGCTTCGTTGTGATGGGATTTGTAGGGTTCTTTGTCAAGCTAATCTTCATTCCGATCAACAACATCATCGTTGGATCTGGTTAG ATGGATGCCGTAGATTCAGTCGTTGATCCTCTCAGAGAGTTCGCTAAGGACAGCGTTCGTCTCGTTAAGAGATGTCATAAACCCGATCGCAAGGAATTCACCAAGGTTGCCGTTCGTACCGCTATCGGCTTCGTTGTGATGGGATTTGTAGGGTTCTTTGTCAAGCTAATCTTCATTCCGATCAACAACATCATCGTTGGATCTGGTTAG MDAVDSVVDPLREFAKDSVRLVKRCHKPDRKEFTKVAVRTAIGFVVMGFVGFFVKLIFIPINNIIVGSG Homology
BLAST of HG10020972 vs. NCBI nr
Match: XP_022137357.1 (uncharacterized protein LOC111008832 isoform X1 [Momordica charantia]) HSP 1 Score: 135.2 bits (339), Expect = 2.2e-28 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. NCBI nr
Match: XP_008439824.1 (PREDICTED: protein transport protein Sec61 subunit gamma [Cucumis melo] >XP_011652190.1 protein transport protein Sec61 subunit gamma [Cucumis sativus] >XP_022924215.1 protein transport protein Sec61 subunit gamma isoform X1 [Cucurbita moschata] >XP_022955226.1 protein transport protein Sec61 subunit gamma [Cucurbita moschata] >XP_022994502.1 protein transport protein Sec61 subunit gamma [Cucurbita maxima] >XP_023000906.1 protein transport protein Sec61 subunit gamma isoform X2 [Cucurbita maxima] >XP_023519526.1 protein transport protein Sec61 subunit gamma [Cucurbita pepo subsp. pepo] >XP_023542809.1 protein transport protein Sec61 subunit gamma [Cucurbita pepo subsp. pepo] >XP_038893830.1 protein transport protein Sec61 subunit gamma [Benincasa hispida] >KAA0055337.1 protein transport protein Sec61 subunit gamma [Cucumis melo var. makuwa] >KAG7012319.1 Protein transport protein Sec61 subunit gamma [Cucurbita argyrosperma subsp. argyrosperma] >KAE8652628.1 hypothetical protein Csa_013813 [Cucumis sativus] >TYJ99263.1 protein transport protein Sec61 subunit gamma [Cucumis melo var. makuwa]) HSP 1 Score: 135.2 bits (339), Expect = 2.2e-28 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. NCBI nr
Match: XP_022137358.1 (uncharacterized protein LOC111008832 isoform X2 [Momordica charantia]) HSP 1 Score: 135.2 bits (339), Expect = 2.2e-28 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. NCBI nr
Match: XP_020163946.1 (protein transport protein Sec61 subunit gamma [Aegilops tauschii subsp. strangulata] >XP_037446494.1 protein transport protein Sec61 subunit gamma-like [Triticum dicoccoides] >XP_037452624.1 protein transport protein Sec61 subunit gamma-like [Triticum dicoccoides] >XP_040248138.1 protein transport protein Sec61 subunit gamma [Aegilops tauschii subsp. strangulata] >KAE8791446.1 Protein transport protein Sec61 subunit gamma [Hordeum vulgare] >KAF7089083.1 hypothetical protein CFC21_092131 [Triticum aestivum] >VAI44557.1 unnamed protein product [Triticum turgidum subsp. durum]) HSP 1 Score: 134.8 bits (338), Expect = 2.8e-28 Identity = 68/69 (98.55%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. NCBI nr
Match: RWR75919.1 (protein transport protein Sec61 subunit gamma [Cinnamomum micranthum f. kanehirae] >RWR87005.1 protein transport protein Sec61 subunit gamma [Cinnamomum micranthum f. kanehirae]) HSP 1 Score: 134.8 bits (338), Expect = 2.8e-28 Identity = 68/69 (98.55%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. ExPASy Swiss-Prot
Match: P38385 (Protein transport protein Sec61 subunit gamma OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0178400 PE=3 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 8.2e-31 Identity = 68/69 (98.55%), Postives = 68/69 (98.55%), Query Frame = 0
BLAST of HG10020972 vs. ExPASy Swiss-Prot
Match: P0DI74 (Protein transport protein Sec61 subunit gamma-1 OS=Arabidopsis thaliana OX=3702 GN=SEC61G1 PE=1 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 1.2e-29 Identity = 64/68 (94.12%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. ExPASy Swiss-Prot
Match: P0DI75 (Protein transport protein Sec61 subunit gamma-2 OS=Arabidopsis thaliana OX=3702 GN=SEC61G2 PE=1 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 1.2e-29 Identity = 64/68 (94.12%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. ExPASy Swiss-Prot
Match: Q9SMP2 (Protein transport protein Sec61 subunit gamma-3 OS=Arabidopsis thaliana OX=3702 GN=SEC61G3 PE=1 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 8.5e-28 Identity = 60/68 (88.24%), Postives = 66/68 (97.06%), Query Frame = 0
BLAST of HG10020972 vs. ExPASy Swiss-Prot
Match: Q7Z1B8 (Protein transport protein Sec61 subunit gamma OS=Gryllotalpa orientalis OX=213494 GN=SEC61G PE=3 SV=1) HSP 1 Score: 104.0 bits (258), Expect = 7.0e-22 Identity = 51/68 (75.00%), Postives = 58/68 (85.29%), Query Frame = 0
BLAST of HG10020972 vs. ExPASy TrEMBL
Match: A0A6J1JW08 (protein transport protein Sec61 subunit gamma OS=Cucurbita maxima OX=3661 GN=LOC111490205 PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.0e-28 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. ExPASy TrEMBL
Match: A0A6J1GT74 (protein transport protein Sec61 subunit gamma OS=Cucurbita moschata OX=3662 GN=LOC111457253 PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.0e-28 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. ExPASy TrEMBL
Match: A0A5D3BJ11 (Protein transport protein Sec61 subunit gamma OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold248G004750 PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.0e-28 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. ExPASy TrEMBL
Match: A0A6J1CA50 (uncharacterized protein LOC111008832 isoform X2 OS=Momordica charantia OX=3673 GN=LOC111008832 PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.0e-28 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. ExPASy TrEMBL
Match: A0A6J1C817 (uncharacterized protein LOC111008832 isoform X1 OS=Momordica charantia OX=3673 GN=LOC111008832 PE=3 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.0e-28 Identity = 69/69 (100.00%), Postives = 69/69 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. TAIR 10
Match: AT4G24920.1 (secE/sec61-gamma protein transport protein ) HSP 1 Score: 129.8 bits (325), Expect = 8.4e-31 Identity = 64/68 (94.12%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. TAIR 10
Match: AT5G50460.1 (secE/sec61-gamma protein transport protein ) HSP 1 Score: 129.8 bits (325), Expect = 8.4e-31 Identity = 64/68 (94.12%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10020972 vs. TAIR 10
Match: AT3G48570.1 (secE/sec61-gamma protein transport protein ) HSP 1 Score: 123.6 bits (309), Expect = 6.1e-29 Identity = 60/68 (88.24%), Postives = 66/68 (97.06%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|