HG10018200 (gene) Bottle gourd (Hangzhou Gourd) v1

Overview


Name	HG10018200
Type	gene
Organism	Lagenaria siceraria cv. Hangzhou Gourd (Bottle gourd (Hangzhou Gourd) v1)
Description	Unknown protein
Location	Chr04: 1519343 .. 1519546 (-)
RNA-Seq Expression	HG10018200
Synteny	HG10018200

Sequences

The following sequences are available for this feature:

Gene sequence (with intron)

Legend: CDSpolypeptide

Hold the cursor over a type above to highlight its positions in the sequence below.

ATGCTACCACTACTCTCCACCAGCCACCTCCAACAACCACCACCAACAATCTACTTTGACGAAACTTCTGACAACCATCTCCGACGACCAACCCTGACGACTACCACCAACTTTAGTGACCATCAGTGGCTGCCAACTGATGGCAACCACCATCAATCTACTTCGACGAAACTTCTGACAACCATCTTCGACGACCAACCCTGA

mRNA sequence

ATGCTACCACTACTCTCCACCAGCCACCTCCAACAACCACCACCAACAATCTACTTTGACGAAACTTCTGACAACCATCTCCGACGACCAACCCTGACGACTACCACCAACTTTAGTGACCATCAGTGGCTGCCAACTGATGGCAACCACCATCAATCTACTTCGACGAAACTTCTGACAACCATCTTCGACGACCAACCCTGA

Coding sequence (CDS)

ATGCTACCACTACTCTCCACCAGCCACCTCCAACAACCACCACCAACAATCTACTTTGACGAAACTTCTGACAACCATCTCCGACGACCAACCCTGACGACTACCACCAACTTTAGTGACCATCAGTGGCTGCCAACTGATGGCAACCACCATCAATCTACTTCGACGAAACTTCTGACAACCATCTTCGACGACCAACCCTGA

Protein sequence

MLPLLSTSHLQQPPPTIYFDETSDNHLRRPTLTTTTNFSDHQWLPTDGNHHQSTSTKLLTTIFDDQP

Homology

The following BLAST results are available for this feature:

BLAST of HG10018200 vs.


Match Name	E-value	Identity	Description

BLAST of HG10018200 vs.


Match Name	E-value	Identity	Description

BLAST of HG10018200 vs.


Match Name	E-value	Identity	Description

BLAST of HG10018200 vs.


Match Name	E-value	Identity	Description

InterPro

Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01


IPR Term	IPR Description	Source	Source Term	Source Description	Alignment
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..67
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 1..19
None	No IPR available	MOBIDB_LITE	mobidb-lite	disorder_prediction	coord: 28..67

Relationships

The following mRNA feature(s) are a part of this gene:


Feature Name	Unique Name	Type
HG10018200.1	HG10018200.1	mRNA