HG10017870 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCTAAGTCTCTTTTCCTAGTAGCTTCTCTCCTCGTCTTCCTAGTCGCAGTAGTAGAACCACGAATCGCTTCAAGAAATCGCTCGGAGTCAGAGGTAAACAAGTTCTTACCAATAGAGAATATATCAGATCCATACTTTCAAAACCTTGGAGAGTGGGGAGTAGATGAACACAATAAAGAAGCCAAAAGTGATCTCAAGTTCCAGGAAGTATATAGTGGTACTTATGAACATAGAACAGGCTTAAATTACAACCTCCATTTAAGAGCCTTAGATGGGGTAGTAAGTGGCAACTATGCAGCCCATGTCTATGTAACATTGCAAGGTAATTTGGATCTCATCCAATTCTATGCTATCCATTATGATGATCTTCAACAAGTCGACGACTCCTCTGCCCTTGTTTGA ATGGCTAAGTCTCTTTTCCTAGTAGCTTCTCTCCTCGTCTTCCTAGTCGCAGTAGTAGAACCACGAATCGCTTCAAGAAATCGCTCGGAGTCAGAGGTAAACAAGTTCTTACCAATAGAGAATATATCAGATCCATACTTTCAAAACCTTGGAGAGTGGGGAGTAGATGAACACAATAAAGAAGCCAAAAGTGATCTCAAGTTCCAGGAAGTATATAGTGGTACTTATGAACATAGAACAGGCTTAAATTACAACCTCCATTTAAGAGCCTTAGATGGGGTAGTAAGTGGCAACTATGCAGCCCATGTCTATGTAACATTGCAAGGTAATTTGGATCTCATCCAATTCTATGCTATCCATTATGATGATCTTCAACAAGTCGACGACTCCTCTGCCCTTGTTTGA ATGGCTAAGTCTCTTTTCCTAGTAGCTTCTCTCCTCGTCTTCCTAGTCGCAGTAGTAGAACCACGAATCGCTTCAAGAAATCGCTCGGAGTCAGAGGTAAACAAGTTCTTACCAATAGAGAATATATCAGATCCATACTTTCAAAACCTTGGAGAGTGGGGAGTAGATGAACACAATAAAGAAGCCAAAAGTGATCTCAAGTTCCAGGAAGTATATAGTGGTACTTATGAACATAGAACAGGCTTAAATTACAACCTCCATTTAAGAGCCTTAGATGGGGTAGTAAGTGGCAACTATGCAGCCCATGTCTATGTAACATTGCAAGGTAATTTGGATCTCATCCAATTCTATGCTATCCATTATGATGATCTTCAACAAGTCGACGACTCCTCTGCCCTTGTTTGA MAKSLFLVASLLVFLVAVVEPRIASRNRSESEVNKFLPIENISDPYFQNLGEWGVDEHNKEAKSDLKFQEVYSGTYEHRTGLNYNLHLRALDGVVSGNYAAHVYVTLQGNLDLIQFYAIHYDDLQQVDDSSALV Homology
BLAST of HG10017870 vs. NCBI nr
Match: XP_022142674.1 (cysteine proteinase inhibitor 1-like [Momordica charantia]) HSP 1 Score: 108.6 bits (270), Expect = 4.2e-20 Identity = 61/119 (51.26%), Postives = 83/119 (69.75%), Query Frame = 0
BLAST of HG10017870 vs. NCBI nr
Match: KAG6583729.1 (Cysteine proteinase inhibitor 5, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 100.1 bits (248), Expect = 1.5e-17 Identity = 56/119 (47.06%), Postives = 78/119 (65.55%), Query Frame = 0
BLAST of HG10017870 vs. NCBI nr
Match: XP_023520817.1 (cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo] >XP_023521297.1 cysteine proteinase inhibitor 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 99.4 bits (246), Expect = 2.5e-17 Identity = 56/119 (47.06%), Postives = 78/119 (65.55%), Query Frame = 0
BLAST of HG10017870 vs. NCBI nr
Match: XP_038895825.1 (cysteine proteinase inhibitor 5-like [Benincasa hispida]) HSP 1 Score: 99.0 bits (245), Expect = 3.3e-17 Identity = 54/119 (45.38%), Postives = 75/119 (63.03%), Query Frame = 0
BLAST of HG10017870 vs. NCBI nr
Match: KAG6583730.1 (Cysteine proteinase inhibitor 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 98.6 bits (244), Expect = 4.3e-17 Identity = 55/119 (46.22%), Postives = 77/119 (64.71%), Query Frame = 0
BLAST of HG10017870 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 62.0 bits (149), Expect = 5.9e-09 Identity = 41/99 (41.41%), Postives = 59/99 (59.60%), Query Frame = 0
BLAST of HG10017870 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 60.1 bits (144), Expect = 2.2e-08 Identity = 34/94 (36.17%), Postives = 53/94 (56.38%), Query Frame = 0
BLAST of HG10017870 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 58.9 bits (141), Expect = 5.0e-08 Identity = 33/95 (34.74%), Postives = 52/95 (54.74%), Query Frame = 0
BLAST of HG10017870 vs. ExPASy Swiss-Prot
Match: Q10Q46 (Cysteine proteinase inhibitor 6 OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0210200 PE=3 SV=1) HSP 1 Score: 55.5 bits (132), Expect = 5.5e-07 Identity = 29/70 (41.43%), Postives = 42/70 (60.00%), Query Frame = 0
BLAST of HG10017870 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 52.8 bits (125), Expect = 3.6e-06 Identity = 33/93 (35.48%), Postives = 52/93 (55.91%), Query Frame = 0
BLAST of HG10017870 vs. ExPASy TrEMBL
Match: A0A6J1CM53 (cysteine proteinase inhibitor 1-like OS=Momordica charantia OX=3673 GN=LOC111012731 PE=4 SV=1) HSP 1 Score: 108.6 bits (270), Expect = 2.0e-20 Identity = 61/119 (51.26%), Postives = 83/119 (69.75%), Query Frame = 0
BLAST of HG10017870 vs. ExPASy TrEMBL
Match: A0A6J1EMY2 (cysteine proteinase inhibitor 1-like OS=Cucurbita moschata OX=3662 GN=LOC111434041 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 1.8e-16 Identity = 53/119 (44.54%), Postives = 76/119 (63.87%), Query Frame = 0
BLAST of HG10017870 vs. ExPASy TrEMBL
Match: A0A0A0LYM0 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G183070 PE=4 SV=1) HSP 1 Score: 91.7 bits (226), Expect = 2.6e-15 Identity = 50/117 (42.74%), Postives = 76/117 (64.96%), Query Frame = 0
BLAST of HG10017870 vs. ExPASy TrEMBL
Match: A0A6J1IJX9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111475533 PE=4 SV=1) HSP 1 Score: 91.3 bits (225), Expect = 3.4e-15 Identity = 50/119 (42.02%), Postives = 74/119 (62.18%), Query Frame = 0
BLAST of HG10017870 vs. ExPASy TrEMBL
Match: A0A6J1IGE9 (cysteine proteinase inhibitor 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474507 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 5.7e-15 Identity = 50/119 (42.02%), Postives = 74/119 (62.18%), Query Frame = 0
BLAST of HG10017870 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 62.0 bits (149), Expect = 4.2e-10 Identity = 41/99 (41.41%), Postives = 59/99 (59.60%), Query Frame = 0
BLAST of HG10017870 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 52.8 bits (125), Expect = 2.5e-07 Identity = 33/93 (35.48%), Postives = 52/93 (55.91%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|