![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
HG10017811 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGCAAATTTTGTCTATGAAAGGCTTGTGCCTTTTGGTGGTCATGATGCTGGTTGTTGTTAATAAAACTCAACTCGCGAATGCAGTGAAATGTGAGCCAAAAGAGTTGAGATCATGTCTTTTGGCCTTCACAATGTCGATGGAGCCATCATCAGCTTGCTGCAACAAGGTGAAGGAACATAGACCATGCTATTGTGGGTACAAGAAAAATCCAAAGATTCAACCATATTTGCAATATGATGCCACCAAAAAAATAATTTCTCAATGTGGCGTTGCCATTCCGACTTGCTAA ATGAAGCAAATTTTGTCTATGAAAGGCTTGTGCCTTTTGGTGGTCATGATGCTGGTTGTTGTTAATAAAACTCAACTCGCGAATGCAGTGAAATGTGAGCCAAAAGAGTTGAGATCATGTCTTTTGGCCTTCACAATGTCGATGGAGCCATCATCAGCTTGCTGCAACAAGGTGAAGGAACATAGACCATGCTATTGTGGGTACAAGAAAAATCCAAAGATTCAACCATATTTGCAATATGATGCCACCAAAAAAATAATTTCTCAATGTGGCGTTGCCATTCCGACTTGCTAA ATGAAGCAAATTTTGTCTATGAAAGGCTTGTGCCTTTTGGTGGTCATGATGCTGGTTGTTGTTAATAAAACTCAACTCGCGAATGCAGTGAAATGTGAGCCAAAAGAGTTGAGATCATGTCTTTTGGCCTTCACAATGTCGATGGAGCCATCATCAGCTTGCTGCAACAAGGTGAAGGAACATAGACCATGCTATTGTGGGTACAAGAAAAATCCAAAGATTCAACCATATTTGCAATATGATGCCACCAAAAAAATAATTTCTCAATGTGGCGTTGCCATTCCGACTTGCTAA MKQILSMKGLCLLVVMMLVVVNKTQLANAVKCEPKELRSCLLAFTMSMEPSSACCNKVKEHRPCYCGYKKNPKIQPYLQYDATKKIISQCGVAIPTC Homology
BLAST of HG10017811 vs. NCBI nr
Match: KGN66906.1 (hypothetical protein Csa_006987 [Cucumis sativus]) HSP 1 Score: 133.7 bits (335), Expect = 8.8e-28 Identity = 63/91 (69.23%), Postives = 75/91 (82.42%), Query Frame = 0
BLAST of HG10017811 vs. NCBI nr
Match: KAE8648143.1 (hypothetical protein Csa_023893, partial [Cucumis sativus]) HSP 1 Score: 107.5 bits (267), Expect = 6.8e-20 Identity = 45/83 (54.22%), Postives = 61/83 (73.49%), Query Frame = 0
BLAST of HG10017811 vs. NCBI nr
Match: KAE8648147.1 (hypothetical protein Csa_023900, partial [Cucumis sativus]) HSP 1 Score: 105.9 bits (263), Expect = 2.0e-19 Identity = 44/73 (60.27%), Postives = 55/73 (75.34%), Query Frame = 0
BLAST of HG10017811 vs. NCBI nr
Match: KAF7130178.1 (hypothetical protein RHSIM_Rhsim10G0070600 [Rhododendron simsii]) HSP 1 Score: 98.2 bits (243), Expect = 4.1e-17 Identity = 45/97 (46.39%), Postives = 64/97 (65.98%), Query Frame = 0
BLAST of HG10017811 vs. NCBI nr
Match: XP_022143278.1 (non-specific lipid-transfer protein 2-like [Momordica charantia]) HSP 1 Score: 95.5 bits (236), Expect = 2.7e-16 Identity = 43/93 (46.24%), Postives = 61/93 (65.59%), Query Frame = 0
BLAST of HG10017811 vs. ExPASy Swiss-Prot
Match: Q43681 (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata OX=3917 PE=2 SV=1) HSP 1 Score: 89.4 bits (220), Expect = 2.5e-17 Identity = 41/97 (42.27%), Postives = 58/97 (59.79%), Query Frame = 0
BLAST of HG10017811 vs. ExPASy Swiss-Prot
Match: P86809 (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum OX=278110 PE=1 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 4.1e-12 Identity = 29/63 (46.03%), Postives = 40/63 (63.49%), Query Frame = 0
BLAST of HG10017811 vs. ExPASy Swiss-Prot
Match: P82353 (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca OX=36596 PE=1 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 3.5e-11 Identity = 27/68 (39.71%), Postives = 37/68 (54.41%), Query Frame = 0
BLAST of HG10017811 vs. ExPASy Swiss-Prot
Match: Q10ST8 (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. japonica OX=39947 GN=LTP-2 PE=1 SV=1) HSP 1 Score: 57.8 bits (138), Expect = 8.1e-08 Identity = 21/66 (31.82%), Postives = 37/66 (56.06%), Query Frame = 0
BLAST of HG10017811 vs. ExPASy Swiss-Prot
Match: A2XBN5 (Non-specific lipid-transfer protein 2 OS=Oryza sativa subsp. indica OX=39946 GN=LTP-2 PE=3 SV=2) HSP 1 Score: 54.3 bits (129), Expect = 8.9e-07 Identity = 25/88 (28.41%), Postives = 42/88 (47.73%), Query Frame = 0
BLAST of HG10017811 vs. ExPASy TrEMBL
Match: A0A0A0M3W7 (AAI domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G711160 PE=4 SV=1) HSP 1 Score: 133.7 bits (335), Expect = 4.3e-28 Identity = 63/91 (69.23%), Postives = 75/91 (82.42%), Query Frame = 0
BLAST of HG10017811 vs. ExPASy TrEMBL
Match: A0A6J1CQB8 (non-specific lipid-transfer protein 2-like OS=Momordica charantia OX=3673 GN=LOC111013188 PE=4 SV=1) HSP 1 Score: 95.5 bits (236), Expect = 1.3e-16 Identity = 43/93 (46.24%), Postives = 61/93 (65.59%), Query Frame = 0
BLAST of HG10017811 vs. ExPASy TrEMBL
Match: A0A2Z6NR57 (AAI domain-containing protein OS=Trifolium subterraneum OX=3900 GN=TSUD_180120 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 3.8e-16 Identity = 42/94 (44.68%), Postives = 60/94 (63.83%), Query Frame = 0
BLAST of HG10017811 vs. ExPASy TrEMBL
Match: A0A5C7IL66 (AAI domain-containing protein OS=Acer yangbiense OX=1000413 GN=EZV62_004968 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 3.8e-16 Identity = 42/97 (43.30%), Postives = 64/97 (65.98%), Query Frame = 0
BLAST of HG10017811 vs. ExPASy TrEMBL
Match: A0A5C7ILK8 (AAI domain-containing protein OS=Acer yangbiense OX=1000413 GN=EZV62_004965 PE=4 SV=1) HSP 1 Score: 94.0 bits (232), Expect = 3.8e-16 Identity = 42/97 (43.30%), Postives = 65/97 (67.01%), Query Frame = 0
BLAST of HG10017811 vs. TAIR 10
Match: AT1G48750.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 73.2 bits (178), Expect = 1.3e-13 Identity = 34/97 (35.05%), Postives = 55/97 (56.70%), Query Frame = 0
BLAST of HG10017811 vs. TAIR 10
Match: AT3G18280.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 72.4 bits (176), Expect = 2.2e-13 Identity = 34/92 (36.96%), Postives = 51/92 (55.43%), Query Frame = 0
BLAST of HG10017811 vs. TAIR 10
Match: AT1G66850.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 69.7 bits (169), Expect = 1.5e-12 Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 0
BLAST of HG10017811 vs. TAIR 10
Match: AT5G38170.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 67.0 bits (162), Expect = 9.5e-12 Identity = 27/68 (39.71%), Postives = 39/68 (57.35%), Query Frame = 0
BLAST of HG10017811 vs. TAIR 10
Match: AT5G38160.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 65.1 bits (157), Expect = 3.6e-11 Identity = 27/68 (39.71%), Postives = 38/68 (55.88%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|