![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
HG10017386 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATTGGTGAACCCGCAGATCCATTTGCAACTCCTTTGGAAATATTGCCGGAATGGTATTTCTTTCCCGTATTTCAAATACTTCGTACAGTGCCAAATAAGTTATTGGGTGTTCTTTTAATGGTTTCCGTACCGGCGGGATTATTAACTGTACCGTTTTTGGAGAATGTCAATAAATTCCAAAATCCATTTCGTCGTCCAGTAGCGACAACCGTCTTTTTGATTGGTACCGCAGTAGCCCTTTGGTTGGGTATTGGAGCAACATTACCGATTGATAAATCCCTAACTTTAGGTCTTTTTTAA ATGATTGGTGAACCCGCAGATCCATTTGCAACTCCTTTGGAAATATTGCCGGAATGGTATTTCTTTCCCGTATTTCAAATACTTCGTACAGTGCCAAATAAGTTATTGGGTGTTCTTTTAATGGTTTCCGTACCGGCGGGATTATTAACTGTACCGTTTTTGGAGAATGTCAATAAATTCCAAAATCCATTTCGTCGTCCAGTAGCGACAACCGTCTTTTTGATTGGTACCGCAGTAGCCCTTTGGTTGGGTATTGGAGCAACATTACCGATTGATAAATCCCTAACTTTAGGTCTTTTTTAA ATGATTGGTGAACCCGCAGATCCATTTGCAACTCCTTTGGAAATATTGCCGGAATGGTATTTCTTTCCCGTATTTCAAATACTTCGTACAGTGCCAAATAAGTTATTGGGTGTTCTTTTAATGGTTTCCGTACCGGCGGGATTATTAACTGTACCGTTTTTGGAGAATGTCAATAAATTCCAAAATCCATTTCGTCGTCCAGTAGCGACAACCGTCTTTTTGATTGGTACCGCAGTAGCCCTTTGGTTGGGTATTGGAGCAACATTACCGATTGATAAATCCCTAACTTTAGGTCTTTTTTAA MIGEPADPFATPLEILPEWYFFPVFQILRTVPNKLLGVLLMVSVPAGLLTVPFLENVNKFQNPFRRPVATTVFLIGTAVALWLGIGATLPIDKSLTLGLF Homology
BLAST of HG10017386 vs. NCBI nr
Match: YP_009461758.1 (cytochrome b/f [Chionanthus parkinsonii] >YP_009547847.1 PetD [Petunia x hybrida] >YP_009695105.1 PetD [Philadelphus calvescens] >YP_009698906.1 PetD [Carpenteria californica] >YP_009752781.1 cytochrome b6/f subunit IV [Cyclantheropsis parviflora] >YP_009915444.1 cytochrome b6/f complex subunit IV [Calibrachoa hybrid cultivar] >YP_009930664.1 cytochrome b6/f complex subunit IV [Petunia exserta] >QHN53524.1 cytochrome b6/f complex subunit IV [Oreocnide frutescens] >QWW33861.1 cytochrome b6/f complex subunit IV [Thermopsis alpina] >QWW33945.1 cytochrome b6/f complex subunit IV [Thermopsis lanceolata] >QWW34029.1 cytochrome b6/f complex subunit IV [Thermopsis turkestanica] >AUG33683.1 PetD [Petunia x hybrida]) HSP 1 Score: 201.4 bits (511), Expect = 3.6e-48 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. NCBI nr
Match: QWQ51329.1 (cytochrome b6-f complex subunit IV [Dickinsia hydrocotyloides]) HSP 1 Score: 201.4 bits (511), Expect = 3.6e-48 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. NCBI nr
Match: YP_009627422.1 (cytochrome b6/f complex subunit IV [Tinospora cordifolia] >QCC70872.1 cytochrome b6/f complex subunit IV [Tinospora cordifolia] >QJF59506.1 cytochrome b6/f complex subunit IV [Tinospora sinensis]) HSP 1 Score: 201.4 bits (511), Expect = 3.6e-48 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. NCBI nr
Match: QYF07576.1 (cytochrome b6/f complex subunit IV [Prinsepia utilis]) HSP 1 Score: 201.4 bits (511), Expect = 3.6e-48 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. NCBI nr
Match: ADD31066.1 (cytochrome b6/f complex subunit IV protein [Ficus sp. Moore 315]) HSP 1 Score: 201.4 bits (511), Expect = 3.6e-48 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. ExPASy Swiss-Prot
Match: Q7FNS2 (Cytochrome b6-f complex subunit 4 OS=Atropa belladonna OX=33113 GN=petD PE=3 SV=1) HSP 1 Score: 201.4 bits (511), Expect = 4.7e-51 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. ExPASy Swiss-Prot
Match: Q4VZK4 (Cytochrome b6-f complex subunit 4 OS=Cucumis sativus OX=3659 GN=petD PE=3 SV=1) HSP 1 Score: 201.4 bits (511), Expect = 4.7e-51 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. ExPASy Swiss-Prot
Match: Q2L939 (Cytochrome b6-f complex subunit 4 OS=Gossypium hirsutum OX=3635 GN=petD PE=3 SV=1) HSP 1 Score: 201.4 bits (511), Expect = 4.7e-51 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. ExPASy Swiss-Prot
Match: Q1KXS8 (Cytochrome b6-f complex subunit 4 OS=Helianthus annuus OX=4232 GN=petD PE=3 SV=1) HSP 1 Score: 201.4 bits (511), Expect = 4.7e-51 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. ExPASy Swiss-Prot
Match: Q06RA1 (Cytochrome b6-f complex subunit 4 OS=Jasminum nudiflorum OX=126431 GN=petD PE=3 SV=1) HSP 1 Score: 201.4 bits (511), Expect = 4.7e-51 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. ExPASy TrEMBL
Match: A0A7H1KFU8 (Cytochrome b6-f complex subunit 4 OS=Meconopsis henrici OX=248836 GN=petD PE=3 SV=1) HSP 1 Score: 201.4 bits (511), Expect = 1.7e-48 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. ExPASy TrEMBL
Match: A0A292G397 (Cytochrome b6-f complex subunit 4 OS=Vitis x champinii OX=884146 GN=petD PE=3 SV=1) HSP 1 Score: 201.4 bits (511), Expect = 1.7e-48 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. ExPASy TrEMBL
Match: A0A1U9YE37 (Cytochrome b6-f complex subunit 4 OS=Rehmannia glutinosa OX=99300 GN=petD PE=3 SV=1) HSP 1 Score: 201.4 bits (511), Expect = 1.7e-48 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. ExPASy TrEMBL
Match: A0A6B9TT79 (Cytochrome b6-f complex subunit 4 OS=Gonostegia hirta OX=648870 GN=petD PE=3 SV=1) HSP 1 Score: 201.4 bits (511), Expect = 1.7e-48 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. ExPASy TrEMBL
Match: A0A1U8LXQ6 (Cytochrome b OS=Gossypium hirsutum OX=3635 GN=LOC107931915 PE=3 SV=1) HSP 1 Score: 201.4 bits (511), Expect = 1.7e-48 Identity = 100/100 (100.00%), Postives = 100/100 (100.00%), Query Frame = 0
BLAST of HG10017386 vs. TAIR 10
Match: ATCG00730.1 (photosynthetic electron transfer D ) HSP 1 Score: 199.9 bits (507), Expect = 9.6e-52 Identity = 99/100 (99.00%), Postives = 99/100 (99.00%), Query Frame = 0
BLAST of HG10017386 vs. TAIR 10
Match: AT2G07727.1 (Di-haem cytochrome, transmembrane;Cytochrome b/b6, C-terminal ) HSP 1 Score: 58.5 bits (140), Expect = 3.5e-09 Identity = 33/88 (37.50%), Postives = 51/88 (57.95%), Query Frame = 0
BLAST of HG10017386 vs. TAIR 10
Match: ATMG00220.1 (apocytochrome b ) HSP 1 Score: 58.5 bits (140), Expect = 3.5e-09 Identity = 33/88 (37.50%), Postives = 51/88 (57.95%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|