HG10017385 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAAGAGTTGCGTGAATCAAAAATCCAAGGGAGGTTCATGGCCAAGGGTAAAGATGCCCGAGTAACAGTTATTTTGGAATGTACTCATTGTGTTCGAAACGGTGTTAATAAGGAATCAATCGGGATTTCCAGATATATTACTCAAAAGAATCGACACAATACGCCTAGTCGATTGGAATTGAGAAAATTCTGTCCCCGTTGTTACAAACATACGATTCATGGGGAGATAAAGAAATAG ATGGAAGAGTTGCGTGAATCAAAAATCCAAGGGAGGTTCATGGCCAAGGGTAAAGATGCCCGAGTAACAGTTATTTTGGAATGTACTCATTGTGTTCGAAACGGTGTTAATAAGGAATCAATCGGGATTTCCAGATATATTACTCAAAAGAATCGACACAATACGCCTAGTCGATTGGAATTGAGAAAATTCTGTCCCCGTTGTTACAAACATACGATTCATGGGGAGATAAAGAAATAG ATGGAAGAGTTGCGTGAATCAAAAATCCAAGGGAGGTTCATGGCCAAGGGTAAAGATGCCCGAGTAACAGTTATTTTGGAATGTACTCATTGTGTTCGAAACGGTGTTAATAAGGAATCAATCGGGATTTCCAGATATATTACTCAAAAGAATCGACACAATACGCCTAGTCGATTGGAATTGAGAAAATTCTGTCCCCGTTGTTACAAACATACGATTCATGGGGAGATAAAGAAATAG MEELRESKIQGRFMAKGKDARVTVILECTHCVRNGVNKESIGISRYITQKNRHNTPSRLELRKFCPRCYKHTIHGEIKK Homology
BLAST of HG10017385 vs. NCBI nr
Match: QJF46404.1 (ribosomal protein L33 [Cucumis melo]) HSP 1 Score: 164.1 bits (414), Expect = 5.0e-37 Identity = 78/79 (98.73%), Postives = 78/79 (98.73%), Query Frame = 0
BLAST of HG10017385 vs. NCBI nr
Match: YP_009456167.1 (ribosomal protein L33 [Lagenaria siceraria] >QNM38552.1 ribosomal protein L33 [Lagenaria siceraria var. microcarpa] >AHM88721.1 ribosomal protein L33 [Lagenaria siceraria] >AHM89070.1 ribosomal protein L33 [Lagenaria siceraria] >AHM89188.1 ribosomal protein L33 [Lagenaria siceraria] >AHM89307.1 ribosomal protein L33 [Lagenaria siceraria]) HSP 1 Score: 142.5 bits (358), Expect = 1.5e-30 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of HG10017385 vs. NCBI nr
Match: YP_009387665.1 (ribosomal protein L33 [Hansenia forbesii] >YP_009387835.1 ribosomal protein L33 [Hansenia forrestii] >QPG23972.1 ribosomal protein L33 [Hansenia oviformis] >ART32609.1 ribosomal protein L33 [Hansenia forbesii] >ART32779.1 ribosomal protein L33 [Hansenia forrestii] >QHV38023.1 ribosomal protein L33 [Hansenia forbesii] >QHV38108.1 ribosomal protein L33 [Hansenia forbesii]) HSP 1 Score: 141.4 bits (355), Expect = 3.4e-30 Identity = 67/79 (84.81%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of HG10017385 vs. NCBI nr
Match: YP_009387580.1 (ribosomal protein L33 [Hansenia weberbaueriana] >YP_010116928.1 ribosomal protein L33 [Haplosphaera himalayensis] >QHS71225.1 ribosomal protein L33 [Haplosphaera phaea] >QHV38448.1 ribosomal protein L33 [Hansenia forrestii] >ART32524.1 ribosomal protein L33 [Hansenia weberbaueriana] >QHV37598.1 ribosomal protein L33 [Hansenia weberbaueriana] >QHV37683.1 ribosomal protein L33 [Hansenia weberbaueriana]) HSP 1 Score: 141.4 bits (355), Expect = 3.4e-30 Identity = 67/79 (84.81%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of HG10017385 vs. NCBI nr
Match: YP_004841804.1 (ribosomal protein L33 [Cucumis melo subsp. melo] >YP_009236301.1 ribosomal protein L33 [Gynostemma pentaphyllum] >YP_009346505.1 ribosomal protein L33 [Cucumis x hytivus] >YP_009420815.1 ribosomal protein L33 [Citrullus colocynthis] >YP_009431578.1 ribosomal protein L33 [Citrullus amarus] >YP_009431663.1 ribosomal protein L33 [Citrullus rehmii] >YP_009440178.1 ribosomal protein L33 [Gynostemma longipes] >YP_009440265.1 ribosomal protein L33 [Gynostemma burmanicum (nom. inval.)] >YP_009440352.1 ribosomal protein L33 [Gynostemma pubescens] >YP_009526323.1 ribosomal protein L33 [Hemsleya lijiangensis] >YP_009751759.1 ribosomal protein L33 [Herpetospermum pedunculosum] >YP_009752348.1 ribosomal protein L33 [Bryonia marmorata] >YP_009860094.1 ribosomal protein L33 [Cucumis melo subsp. agrestis] >YP_010119755.1 ribosomal protein L33 [Hemsleya zhejiangensis] >YP_010131115.1 ribosomal protein L33 [Benincasa hispida] >AHM88780.1 ribosomal protein L33 [Lagenaria siceraria] >APW82482.1 ribosomal protein L33 [Citrullus lanatus subsp. vulgaris] >ASY96612.1 ribosomal protein L33 [Cucumis melo var. conomon] >ASY96699.1 ribosomal protein L33 [Cucumis melo var. makuwa] >ASY96786.1 ribosomal protein L33 [Cucumis melo var. momordica] >ASY96873.1 ribosomal protein L33 [Cucumis melo var. dudaim] >ASY96960.1 ribosomal protein L33 [Cucumis melo var. cantalupo] >ASY97134.1 ribosomal protein L33 [Cucumis melo var. inodorus] >ASY97308.1 ribosomal protein L33 [Cucumis melo var. flexuosus] >AXU40454.1 ribosomal protein L33 [Gomphogyne cissiformis var. villosa] >AXU40628.1 ribosomal protein L33 [Gomphogyne cissiformis var. cissiformis] >QCY72863.1 ribosomal protein L33 [Cucumis hystrix] >QRW36576.1 ribosomal protein L33 [Cucumis melo] >QZL38614.1 ribosomal protein L33 [Citrullus naudinianus] >QZL38702.1 ribosomal protein L33 [Citrullus ecirrhosus]) HSP 1 Score: 139.4 bits (350), Expect = 1.3e-29 Identity = 65/66 (98.48%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of HG10017385 vs. ExPASy Swiss-Prot
Match: Q2QD68 (50S ribosomal protein L33, chloroplastic OS=Cucumis sativus OX=3659 GN=rpl33 PE=3 SV=1) HSP 1 Score: 138.3 bits (347), Expect = 3.8e-32 Identity = 64/66 (96.97%), Postives = 65/66 (98.48%), Query Frame = 0
BLAST of HG10017385 vs. ExPASy Swiss-Prot
Match: B1A956 (50S ribosomal protein L33, chloroplastic OS=Carica papaya OX=3649 GN=rpl33 PE=3 SV=1) HSP 1 Score: 134.0 bits (336), Expect = 7.2e-31 Identity = 62/66 (93.94%), Postives = 63/66 (95.45%), Query Frame = 0
BLAST of HG10017385 vs. ExPASy Swiss-Prot
Match: A6MM57 (50S ribosomal protein L33, chloroplastic OS=Buxus microphylla OX=153571 GN=rpl33 PE=3 SV=1) HSP 1 Score: 131.7 bits (330), Expect = 3.6e-30 Identity = 61/66 (92.42%), Postives = 62/66 (93.94%), Query Frame = 0
BLAST of HG10017385 vs. ExPASy Swiss-Prot
Match: Q49KX8 (50S ribosomal protein L33, chloroplastic OS=Eucalyptus globulus subsp. globulus OX=71271 GN=rpl33 PE=3 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.3e-29 Identity = 59/66 (89.39%), Postives = 62/66 (93.94%), Query Frame = 0
BLAST of HG10017385 vs. ExPASy Swiss-Prot
Match: A0ZZ56 (50S ribosomal protein L33, chloroplastic OS=Gossypium barbadense OX=3634 GN=rpl33 PE=3 SV=1) HSP 1 Score: 129.0 bits (323), Expect = 2.3e-29 Identity = 59/66 (89.39%), Postives = 61/66 (92.42%), Query Frame = 0
BLAST of HG10017385 vs. ExPASy TrEMBL
Match: A0A6M3W1I6 (50S ribosomal protein L33, chloroplastic OS=Cucumis melo OX=3656 GN=rpl33 PE=3 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 2.4e-37 Identity = 78/79 (98.73%), Postives = 78/79 (98.73%), Query Frame = 0
BLAST of HG10017385 vs. ExPASy TrEMBL
Match: X2F867 (50S ribosomal protein L33, chloroplastic OS=Lagenaria siceraria OX=3668 GN=rpl33 PE=3 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 7.5e-31 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of HG10017385 vs. ExPASy TrEMBL
Match: A0A7G9IT58 (50S ribosomal protein L33, chloroplastic OS=Lagenaria siceraria var. microcarpa OX=2726058 GN=rpl33 PE=3 SV=1) HSP 1 Score: 142.5 bits (358), Expect = 7.5e-31 Identity = 66/66 (100.00%), Postives = 66/66 (100.00%), Query Frame = 0
BLAST of HG10017385 vs. ExPASy TrEMBL
Match: A0A1Y0B5C5 (50S ribosomal protein L33, chloroplastic OS=Hansenia forbesii OX=165499 GN=rpl33 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 1.7e-30 Identity = 67/79 (84.81%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of HG10017385 vs. ExPASy TrEMBL
Match: A0A1Y0B534 (50S ribosomal protein L33, chloroplastic OS=Hansenia weberbaueriana OX=54724 GN=rpl33 PE=3 SV=1) HSP 1 Score: 141.4 bits (355), Expect = 1.7e-30 Identity = 67/79 (84.81%), Postives = 71/79 (89.87%), Query Frame = 0
BLAST of HG10017385 vs. TAIR 10
Match: ATCG00640.1 (ribosomal protein L33 ) HSP 1 Score: 125.9 bits (315), Expect = 1.4e-29 Identity = 57/66 (86.36%), Postives = 60/66 (90.91%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|