![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
HG10016670 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGCTGTTCACGTCGGACCAGGTTCTGTTTAGCGACGCCAGGTCCAGGCCACCTGTGAACGCGTGGGCTAGCAACTCCCAAGCCTTAAATAAAGCATTTATTGAAGCTATGACTAAGTTGGGGCGGGTGGGGGTCAAGACTAGTAGAAACGGTAATATTCGGCGCGATTGTGGAGCTTTCAATTGA ATGGGGCTGTTCACGTCGGACCAGGTTCTGTTTAGCGACGCCAGGTCCAGGCCACCTGTGAACGCGTGGGCTAGCAACTCCCAAGCCTTAAATAAAGCATTTATTGAAGCTATGACTAAGTTGGGGCGGGTGGGGGTCAAGACTAGTAGAAACGGTAATATTCGGCGCGATTGTGGAGCTTTCAATTGA ATGGGGCTGTTCACGTCGGACCAGGTTCTGTTTAGCGACGCCAGGTCCAGGCCACCTGTGAACGCGTGGGCTAGCAACTCCCAAGCCTTAAATAAAGCATTTATTGAAGCTATGACTAAGTTGGGGCGGGTGGGGGTCAAGACTAGTAGAAACGGTAATATTCGGCGCGATTGTGGAGCTTTCAATTGA MGLFTSDQVLFSDARSRPPVNAWASNSQALNKAFIEAMTKLGRVGVKTSRNGNIRRDCGAFN Homology
BLAST of HG10016670 vs. NCBI nr
Match: XP_038880856.1 (peroxidase 73-like [Benincasa hispida]) HSP 1 Score: 121.7 bits (304), Expect = 2.2e-24 Identity = 59/62 (95.16%), Postives = 59/62 (95.16%), Query Frame = 0
BLAST of HG10016670 vs. NCBI nr
Match: XP_022978907.1 (peroxidase 73-like [Cucurbita maxima]) HSP 1 Score: 115.5 bits (288), Expect = 1.6e-22 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of HG10016670 vs. NCBI nr
Match: XP_022950891.1 (peroxidase 73-like [Cucurbita moschata] >XP_023543176.1 peroxidase 73-like [Cucurbita pepo subsp. pepo] >KAG6604140.1 Peroxidase 73, partial [Cucurbita argyrosperma subsp. sororia] >KAG7034302.1 Peroxidase 73, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 115.5 bits (288), Expect = 1.6e-22 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of HG10016670 vs. NCBI nr
Match: XP_008440361.1 (PREDICTED: peroxidase 73-like [Cucumis melo] >KAA0036431.1 peroxidase 73-like [Cucumis melo var. makuwa] >TYK12826.1 peroxidase 73-like [Cucumis melo var. makuwa]) HSP 1 Score: 113.6 bits (283), Expect = 6.0e-22 Identity = 54/62 (87.10%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of HG10016670 vs. NCBI nr
Match: XP_023003008.1 (peroxidase 73-like [Cucurbita maxima]) HSP 1 Score: 112.5 bits (280), Expect = 1.3e-21 Identity = 52/62 (83.87%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of HG10016670 vs. ExPASy Swiss-Prot
Match: Q96510 (Peroxidase 35 OS=Arabidopsis thaliana OX=3702 GN=PER35 PE=1 SV=1) HSP 1 Score: 107.1 bits (266), Expect = 7.4e-23 Identity = 51/61 (83.61%), Postives = 54/61 (88.52%), Query Frame = 0
BLAST of HG10016670 vs. ExPASy Swiss-Prot
Match: Q43873 (Peroxidase 73 OS=Arabidopsis thaliana OX=3702 GN=PER73 PE=1 SV=1) HSP 1 Score: 105.9 bits (263), Expect = 1.7e-22 Identity = 50/61 (81.97%), Postives = 53/61 (86.89%), Query Frame = 0
BLAST of HG10016670 vs. ExPASy Swiss-Prot
Match: Q9SZE7 (Peroxidase 51 OS=Arabidopsis thaliana OX=3702 GN=PER51 PE=2 SV=1) HSP 1 Score: 98.2 bits (243), Expect = 3.4e-20 Identity = 45/61 (73.77%), Postives = 52/61 (85.25%), Query Frame = 0
BLAST of HG10016670 vs. ExPASy Swiss-Prot
Match: Q43731 (Peroxidase 50 OS=Arabidopsis thaliana OX=3702 GN=PER50 PE=1 SV=1) HSP 1 Score: 97.4 bits (241), Expect = 5.9e-20 Identity = 45/61 (73.77%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of HG10016670 vs. ExPASy Swiss-Prot
Match: Q96518 (Peroxidase 16 OS=Arabidopsis thaliana OX=3702 GN=PER16 PE=1 SV=2) HSP 1 Score: 82.8 bits (203), Expect = 1.5e-15 Identity = 41/62 (66.13%), Postives = 46/62 (74.19%), Query Frame = 0
BLAST of HG10016670 vs. ExPASy TrEMBL
Match: A0A6J1IMC5 (Peroxidase OS=Cucurbita maxima OX=3661 GN=LOC111478718 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 7.7e-23 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of HG10016670 vs. ExPASy TrEMBL
Match: A0A6J1GG25 (Peroxidase OS=Cucurbita moschata OX=3662 GN=LOC111453852 PE=3 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 7.7e-23 Identity = 54/62 (87.10%), Postives = 58/62 (93.55%), Query Frame = 0
BLAST of HG10016670 vs. ExPASy TrEMBL
Match: A0A5D3CR00 (Peroxidase OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G004180 PE=3 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 2.9e-22 Identity = 54/62 (87.10%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of HG10016670 vs. ExPASy TrEMBL
Match: A0A1S3B0I8 (Peroxidase OS=Cucumis melo OX=3656 GN=LOC103484837 PE=3 SV=1) HSP 1 Score: 113.6 bits (283), Expect = 2.9e-22 Identity = 54/62 (87.10%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of HG10016670 vs. ExPASy TrEMBL
Match: A0A6J1KV86 (Peroxidase OS=Cucurbita maxima OX=3661 GN=LOC111496751 PE=3 SV=1) HSP 1 Score: 112.5 bits (280), Expect = 6.5e-22 Identity = 52/62 (83.87%), Postives = 57/62 (91.94%), Query Frame = 0
BLAST of HG10016670 vs. TAIR 10
Match: AT3G49960.1 (Peroxidase superfamily protein ) HSP 1 Score: 107.1 bits (266), Expect = 5.3e-24 Identity = 51/61 (83.61%), Postives = 54/61 (88.52%), Query Frame = 0
BLAST of HG10016670 vs. TAIR 10
Match: AT5G67400.1 (root hair specific 19 ) HSP 1 Score: 105.9 bits (263), Expect = 1.2e-23 Identity = 50/61 (81.97%), Postives = 53/61 (86.89%), Query Frame = 0
BLAST of HG10016670 vs. TAIR 10
Match: AT4G37530.1 (Peroxidase superfamily protein ) HSP 1 Score: 98.2 bits (243), Expect = 2.4e-21 Identity = 45/61 (73.77%), Postives = 52/61 (85.25%), Query Frame = 0
BLAST of HG10016670 vs. TAIR 10
Match: AT4G37520.1 (Peroxidase superfamily protein ) HSP 1 Score: 97.4 bits (241), Expect = 4.2e-21 Identity = 45/61 (73.77%), Postives = 51/61 (83.61%), Query Frame = 0
BLAST of HG10016670 vs. TAIR 10
Match: AT4G37520.2 (Peroxidase superfamily protein ) HSP 1 Score: 97.4 bits (241), Expect = 4.2e-21 Identity = 45/61 (73.77%), Postives = 51/61 (83.61%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|