
HG10014117 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGTTGAGTTTCGTCTTCAGCAACGGCGTCAGCGACTACAAGCGATGTCCAGTTCCTTTCTCCAGAGACCAGCTTCGCGATATTTTCCTCAAGCACGACGGCGACGGCGACGGCCGACTTTCTCGCTTGGAATTGAAATCGGCCTTCGATTCCTTAGGATCTAATTGGAGCCGTTTCAGAGCTCGTCAGTCTCTCAAAGCCGCCGATTCCGACGGCGATGGTTACGTTACTCTCGATGAACTTGATCGCCTTCTTGATTACGCTGTAAGATGCGATTACGCTATAATTTGA ATGGCGTTGAGTTTCGTCTTCAGCAACGGCGTCAGCGACTACAAGCGATGTCCAGTTCCTTTCTCCAGAGACCAGCTTCGCGATATTTTCCTCAAGCACGACGGCGACGGCGACGGCCGACTTTCTCGCTTGGAATTGAAATCGGCCTTCGATTCCTTAGGATCTAATTGGAGCCGTTTCAGAGCTCGTCAGTCTCTCAAAGCCGCCGATTCCGACGGCGATGGTTACGTTACTCTCGATGAACTTGATCGCCTTCTTGATTACGCTGTAAGATGCGATTACGCTATAATTTGA ATGGCGTTGAGTTTCGTCTTCAGCAACGGCGTCAGCGACTACAAGCGATGTCCAGTTCCTTTCTCCAGAGACCAGCTTCGCGATATTTTCCTCAAGCACGACGGCGACGGCGACGGCCGACTTTCTCGCTTGGAATTGAAATCGGCCTTCGATTCCTTAGGATCTAATTGGAGCCGTTTCAGAGCTCGTCAGTCTCTCAAAGCCGCCGATTCCGACGGCGATGGTTACGTTACTCTCGATGAACTTGATCGCCTTCTTGATTACGCTGTAAGATGCGATTACGCTATAATTTGA MALSFVFSNGVSDYKRCPVPFSRDQLRDIFLKHDGDGDGRLSRLELKSAFDSLGSNWSRFRARQSLKAADSDGDGYVTLDELDRLLDYAVRCDYAII Homology
BLAST of HG10014117 vs. NCBI nr
Match: KGN55186.1 (hypothetical protein Csa_012423 [Cucumis sativus]) HSP 1 Score: 195.3 bits (495), Expect = 2.5e-46 Identity = 94/97 (96.91%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of HG10014117 vs. NCBI nr
Match: KAG6591371.1 (putative calcium-binding protein CML10, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 190.3 bits (482), Expect = 7.9e-45 Identity = 90/96 (93.75%), Postives = 95/96 (98.96%), Query Frame = 0
BLAST of HG10014117 vs. NCBI nr
Match: KAA0064377.1 (Calcium-binding EF-hand [Cucumis melo var. makuwa] >TYK20210.1 Calcium-binding EF-hand [Cucumis melo var. makuwa]) HSP 1 Score: 188.3 bits (477), Expect = 3.0e-44 Identity = 92/97 (94.85%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of HG10014117 vs. NCBI nr
Match: KAG6608480.1 (putative calcium-binding protein CML10, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 162.9 bits (411), Expect = 1.4e-36 Identity = 75/91 (82.42%), Postives = 86/91 (94.51%), Query Frame = 0
BLAST of HG10014117 vs. NCBI nr
Match: KAG7029343.1 (Calcium-binding protein CML37, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 98.6 bits (244), Expect = 3.1e-17 Identity = 44/83 (53.01%), Postives = 61/83 (73.49%), Query Frame = 0
BLAST of HG10014117 vs. ExPASy Swiss-Prot
Match: Q8RZB5 (Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica OX=39947 GN=CML10 PE=2 SV=1) HSP 1 Score: 58.5 bits (140), Expect = 4.7e-08 Identity = 27/68 (39.71%), Postives = 42/68 (61.76%), Query Frame = 0
BLAST of HG10014117 vs. ExPASy Swiss-Prot
Match: Q6L4D4 (Probable calcium-binding protein CML15 OS=Oryza sativa subsp. japonica OX=39947 GN=CML15 PE=2 SV=1) HSP 1 Score: 55.1 bits (131), Expect = 5.2e-07 Identity = 26/62 (41.94%), Postives = 39/62 (62.90%), Query Frame = 0
BLAST of HG10014117 vs. ExPASy Swiss-Prot
Match: Q9LE22 (Probable calcium-binding protein CML27 OS=Arabidopsis thaliana OX=3702 GN=CML27 PE=1 SV=1) HSP 1 Score: 52.0 bits (123), Expect = 4.4e-06 Identity = 22/62 (35.48%), Postives = 40/62 (64.52%), Query Frame = 0
BLAST of HG10014117 vs. ExPASy Swiss-Prot
Match: O64943 (Polcalcin Jun o 2 OS=Juniperus oxycedrus OX=69008 PE=1 SV=2) HSP 1 Score: 52.0 bits (123), Expect = 4.4e-06 Identity = 24/57 (42.11%), Postives = 36/57 (63.16%), Query Frame = 0
BLAST of HG10014117 vs. ExPASy Swiss-Prot
Match: A0T2M3 (Polcalcin Cup a 4 OS=Hesperocyparis arizonica OX=49011 PE=1 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 9.9e-06 Identity = 23/57 (40.35%), Postives = 35/57 (61.40%), Query Frame = 0
BLAST of HG10014117 vs. ExPASy TrEMBL
Match: A0A0A0L4V0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G639740 PE=4 SV=1) HSP 1 Score: 195.3 bits (495), Expect = 1.2e-46 Identity = 94/97 (96.91%), Postives = 97/97 (100.00%), Query Frame = 0
BLAST of HG10014117 vs. ExPASy TrEMBL
Match: A0A5A7VBH2 (Calcium-binding EF-hand OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold134G003470 PE=4 SV=1) HSP 1 Score: 188.3 bits (477), Expect = 1.5e-44 Identity = 92/97 (94.85%), Postives = 95/97 (97.94%), Query Frame = 0
BLAST of HG10014117 vs. ExPASy TrEMBL
Match: A0A7N2KRS3 (Uncharacterized protein OS=Quercus lobata OX=97700 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 4.4e-17 Identity = 44/83 (53.01%), Postives = 60/83 (72.29%), Query Frame = 0
BLAST of HG10014117 vs. ExPASy TrEMBL
Match: A0A2N9FYQ0 (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS20260 PE=4 SV=1) HSP 1 Score: 95.1 bits (235), Expect = 1.7e-16 Identity = 42/86 (48.84%), Postives = 59/86 (68.60%), Query Frame = 0
BLAST of HG10014117 vs. ExPASy TrEMBL
Match: A0A5N6RQV2 (Uncharacterized protein OS=Carpinus fangiana OX=176857 GN=FH972_018544 PE=4 SV=1) HSP 1 Score: 94.7 bits (234), Expect = 2.2e-16 Identity = 47/86 (54.65%), Postives = 61/86 (70.93%), Query Frame = 0
BLAST of HG10014117 vs. TAIR 10
Match: AT1G18210.1 (Calcium-binding EF-hand family protein ) HSP 1 Score: 52.0 bits (123), Expect = 3.1e-07 Identity = 22/62 (35.48%), Postives = 40/62 (64.52%), Query Frame = 0
BLAST of HG10014117 vs. TAIR 10
Match: AT1G18210.2 (Calcium-binding EF-hand family protein ) HSP 1 Score: 52.0 bits (123), Expect = 3.1e-07 Identity = 22/62 (35.48%), Postives = 40/62 (64.52%), Query Frame = 0
BLAST of HG10014117 vs. TAIR 10
Match: AT3G50770.1 (calmodulin-like 41 ) HSP 1 Score: 48.5 bits (114), Expect = 3.5e-06 Identity = 22/65 (33.85%), Postives = 39/65 (60.00%), Query Frame = 0
BLAST of HG10014117 vs. TAIR 10
Match: AT3G03410.1 (EF hand calcium-binding protein family ) HSP 1 Score: 46.2 bits (108), Expect = 1.7e-05 Identity = 22/61 (36.07%), Postives = 36/61 (59.02%), Query Frame = 0
BLAST of HG10014117 vs. TAIR 10
Match: AT1G18530.1 (EF hand calcium-binding protein family ) HSP 1 Score: 45.1 bits (105), Expect = 3.8e-05 Identity = 26/58 (44.83%), Postives = 35/58 (60.34%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|