HG10011166 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGAGAAGGCCCTGAGAATATACGGCGAAGTTTTGAGGTTAGTGCGGCGGTTACCTAAGGACACGAGGCCTTACTACGCCAAGTACGCTCGAGAGAATTTCGTCAACTACAGAGAAGTCGATGCGAACGATGCCAAATCCCTAGAAGAACTCTTCCACGGAGCTTATAACCACTCCGTTTGGGTTCTAAACAAGGTCTAACTCTAAATTCTCTAATCTTTCAATTTTGAAATTGTTTTTTTTTCCCTCTCGATTTGTGGATCCTTTTTGAGGGGGCTGTGGTGATTGGCAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAGTTAA ATGGAGAAGGCCCTGAGAATATACGGCGAAGTTTTGAGGTTAGTGCGGCGGTTACCTAAGGACACGAGGCCTTACTACGCCAAGTACGCTCGAGAGAATTTCGTCAACTACAGAGAAGTCGATGCGAACGATGCCAAATCCCTAGAAGAACTCTTCCACGGAGCTTATAACCACTCCGTTTGGGTTCTAAACAAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAGTTAA ATGGAGAAGGCCCTGAGAATATACGGCGAAGTTTTGAGGTTAGTGCGGCGGTTACCTAAGGACACGAGGCCTTACTACGCCAAGTACGCTCGAGAGAATTTCGTCAACTACAGAGAAGTCGATGCGAACGATGCCAAATCCCTAGAAGAACTCTTCCACGGAGCTTATAACCACTCCGTTTGGGTTCTAAACAAGTATTCGGTGGATGGATCTGCGGCGGATAAGCTGAAGGAGATCTGTTATAGTTAA MEKALRIYGEVLRLVRRLPKDTRPYYAKYARENFVNYREVDANDAKSLEELFHGAYNHSVWVLNKYSVDGSAADKLKEICYS Homology
BLAST of HG10011166 vs. NCBI nr
Match: XP_008456173.1 (PREDICTED: LYR motif-containing protein At3g19508 [Cucumis melo] >KAA0037191.1 LYR motif-containing protein [Cucumis melo var. makuwa] >TYK13881.1 LYR motif-containing protein [Cucumis melo var. makuwa]) HSP 1 Score: 166.0 bits (419), Expect = 1.4e-37 Identity = 79/82 (96.34%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of HG10011166 vs. NCBI nr
Match: XP_038898400.1 (LYR motif-containing protein At3g19508 [Benincasa hispida]) HSP 1 Score: 162.5 bits (410), Expect = 1.5e-36 Identity = 78/82 (95.12%), Postives = 80/82 (97.56%), Query Frame = 0
BLAST of HG10011166 vs. NCBI nr
Match: XP_004140718.1 (LYR motif-containing protein At3g19508 [Cucumis sativus] >KGN57494.1 hypothetical protein Csa_011093 [Cucumis sativus]) HSP 1 Score: 159.1 bits (401), Expect = 1.7e-35 Identity = 75/81 (92.59%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of HG10011166 vs. NCBI nr
Match: XP_022941949.1 (LYR motif-containing protein At3g19508 [Cucurbita moschata] >XP_023512988.1 LYR motif-containing protein At3g19508 [Cucurbita pepo subsp. pepo] >KAG6600304.1 LYR motif-containing protein, partial [Cucurbita argyrosperma subsp. sororia] >KAG7030964.1 LYR motif-containing protein [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 158.3 bits (399), Expect = 2.8e-35 Identity = 77/82 (93.90%), Postives = 79/82 (96.34%), Query Frame = 0
BLAST of HG10011166 vs. NCBI nr
Match: XP_015892821.1 (LYR motif-containing protein At3g19508 [Ziziphus jujuba]) HSP 1 Score: 156.8 bits (395), Expect = 8.2e-35 Identity = 73/82 (89.02%), Postives = 79/82 (96.34%), Query Frame = 0
BLAST of HG10011166 vs. ExPASy Swiss-Prot
Match: Q1G3M2 (LYR motif-containing protein At3g19508 OS=Arabidopsis thaliana OX=3702 GN=At3g19508 PE=3 SV=1) HSP 1 Score: 123.6 bits (309), Expect = 1.0e-27 Identity = 59/81 (72.84%), Postives = 69/81 (85.19%), Query Frame = 0
BLAST of HG10011166 vs. ExPASy Swiss-Prot
Match: A9SNJ1 (LYR motif-containing protein PHYPADRAFT_186863 OS=Physcomitrium patens OX=3218 GN=PHYPADRAFT_186863 PE=3 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 9.5e-10 Identity = 31/58 (53.45%), Postives = 41/58 (70.69%), Query Frame = 0
BLAST of HG10011166 vs. ExPASy TrEMBL
Match: A0A5A7T6G8 (LYR motif-containing protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold832G00680 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 6.6e-38 Identity = 79/82 (96.34%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of HG10011166 vs. ExPASy TrEMBL
Match: A0A1S3C3W4 (LYR motif-containing protein At3g19508 OS=Cucumis melo OX=3656 GN=LOC103496191 PE=4 SV=1) HSP 1 Score: 166.0 bits (419), Expect = 6.6e-38 Identity = 79/82 (96.34%), Postives = 81/82 (98.78%), Query Frame = 0
BLAST of HG10011166 vs. ExPASy TrEMBL
Match: A0A0A0L970 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_3G199560 PE=4 SV=1) HSP 1 Score: 159.1 bits (401), Expect = 8.0e-36 Identity = 75/81 (92.59%), Postives = 78/81 (96.30%), Query Frame = 0
BLAST of HG10011166 vs. ExPASy TrEMBL
Match: A0A6J1FPX9 (LYR motif-containing protein At3g19508 OS=Cucurbita moschata OX=3662 GN=LOC111447159 PE=4 SV=1) HSP 1 Score: 158.3 bits (399), Expect = 1.4e-35 Identity = 77/82 (93.90%), Postives = 79/82 (96.34%), Query Frame = 0
BLAST of HG10011166 vs. ExPASy TrEMBL
Match: A0A6P4A9N6 (LYR motif-containing protein At3g19508 OS=Ziziphus jujuba OX=326968 GN=LOC107427002 PE=4 SV=1) HSP 1 Score: 156.8 bits (395), Expect = 4.0e-35 Identity = 73/82 (89.02%), Postives = 79/82 (96.34%), Query Frame = 0
BLAST of HG10011166 vs. TAIR 10
Match: AT3G19508.1 (unknown protein; LOCATED IN: mitochondrion; Has 34 Blast hits to 34 proteins in 14 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 34; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 123.6 bits (309), Expect = 7.2e-29 Identity = 59/81 (72.84%), Postives = 69/81 (85.19%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
|