HG10011076 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTGGCCGCAAAGAAGACGAAGAAGATCCATGAGAGCATCAACAACAGACTCGCTCTCGTCATGAAGAGTGGGAAATATACCTTGGGATACAAAACCGTCCTCAAAACCTTGAGGAACTCTAAAGGTAAGCTAATTATCATTGCCACAACTGCCCTCCACTCCGAAAGTCTGAGATCGAATACTATGCGATGTTGGCAAAGGTTGGAGTTCACCATTACAACGGAAGCAATGTAG ATGGTGGCCGCAAAGAAGACGAAGAAGATCCATGAGAGCATCAACAACAGACTCGCTCTCGTCATGAAGAGTGGGAAATATACCTTGGGATACAAAACCGTCCTCAAAACCTTGAGGAACTCTAAAGGTAAGCTAATTATCATTGCCACAACTGCCCTCCACTCCGAAAGTCTGAGATCGAATACTATGCGATGTTGGCAAAGGTTGGAGTTCACCATTACAACGGAAGCAATGTAG ATGGTGGCCGCAAAGAAGACGAAGAAGATCCATGAGAGCATCAACAACAGACTCGCTCTCGTCATGAAGAGTGGGAAATATACCTTGGGATACAAAACCGTCCTCAAAACCTTGAGGAACTCTAAAGGTAAGCTAATTATCATTGCCACAACTGCCCTCCACTCCGAAAGTCTGAGATCGAATACTATGCGATGTTGGCAAAGGTTGGAGTTCACCATTACAACGGAAGCAATGTAG MVAAKKTKKIHESINNRLALVMKSGKYTLGYKTVLKTLRNSKGKLIIIATTALHSESLRSNTMRCWQRLEFTITTEAM Homology
BLAST of HG10011076 vs. NCBI nr
Match: TYI76307.1 (hypothetical protein E1A91_D06G067000v1 [Gossypium mustelinum]) HSP 1 Score: 103.6 bits (257), Expect = 7.9e-19 Identity = 58/77 (75.32%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of HG10011076 vs. NCBI nr
Match: MBO8589876.1 (ribosomal L7Ae/L30e/S12e/Gadd45 family protein [Staphylococcus aureus]) HSP 1 Score: 94.7 bits (234), Expect = 3.7e-16 Identity = 54/76 (71.05%), Postives = 56/76 (73.68%), Query Frame = 0
BLAST of HG10011076 vs. NCBI nr
Match: XP_004251199.1 (60S ribosomal protein L30 [Solanum lycopersicum] >XP_015056853.1 60S ribosomal protein L30 [Solanum pennellii] >XP_016548732.1 PREDICTED: 60S ribosomal protein L30 [Capsicum annuum]) HSP 1 Score: 90.9 bits (224), Expect = 5.3e-15 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of HG10011076 vs. NCBI nr
Match: XP_008451087.1 (PREDICTED: 60S ribosomal protein L30 [Cucumis melo] >KAA0055665.1 60S ribosomal protein L30 [Cucumis melo var. makuwa] >TYK09919.1 60S ribosomal protein L30 [Cucumis melo var. makuwa]) HSP 1 Score: 90.9 bits (224), Expect = 5.3e-15 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of HG10011076 vs. NCBI nr
Match: XP_009631814.1 (60S ribosomal protein L30-like [Nicotiana tomentosiformis] >XP_009780771.1 PREDICTED: 60S ribosomal protein L30-like [Nicotiana sylvestris] >XP_016434249.1 PREDICTED: 60S ribosomal protein L30-like [Nicotiana tabacum] >XP_016467820.1 PREDICTED: 60S ribosomal protein L30-like [Nicotiana tabacum] >XP_019265245.1 PREDICTED: 60S ribosomal protein L30-like [Nicotiana attenuata]) HSP 1 Score: 90.9 bits (224), Expect = 5.3e-15 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of HG10011076 vs. ExPASy Swiss-Prot
Match: O49884 (60S ribosomal protein L30 OS=Lupinus luteus OX=3873 GN=RPL30 PE=3 SV=1) HSP 1 Score: 87.4 bits (215), Expect = 7.6e-17 Identity = 46/49 (93.88%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of HG10011076 vs. ExPASy Swiss-Prot
Match: Q9M5M6 (60S ribosomal protein L30 OS=Euphorbia esula OX=3993 GN=RPL30 PE=3 SV=1) HSP 1 Score: 81.3 bits (199), Expect = 5.5e-15 Identity = 42/49 (85.71%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of HG10011076 vs. ExPASy Swiss-Prot
Match: Q9C8F7 (Putative 60S ribosomal protein L30-1 OS=Arabidopsis thaliana OX=3702 GN=RPL30A PE=3 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.2e-14 Identity = 41/50 (82.00%), Postives = 48/50 (96.00%), Query Frame = 0
BLAST of HG10011076 vs. ExPASy Swiss-Prot
Match: Q8VZ19 (60S ribosomal protein L30-2 OS=Arabidopsis thaliana OX=3702 GN=RPL30B PE=3 SV=1) HSP 1 Score: 77.8 bits (190), Expect = 6.1e-14 Identity = 40/50 (80.00%), Postives = 45/50 (90.00%), Query Frame = 0
BLAST of HG10011076 vs. ExPASy Swiss-Prot
Match: Q9LSA3 (60S ribosomal protein L30-3 OS=Arabidopsis thaliana OX=3702 GN=RPL30C PE=3 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.8e-13 Identity = 39/50 (78.00%), Postives = 46/50 (92.00%), Query Frame = 0
BLAST of HG10011076 vs. ExPASy TrEMBL
Match: A0A5D2UFA5 (Ribosomal_L7Ae domain-containing protein OS=Gossypium mustelinum OX=34275 GN=E1A91_D06G067000v1 PE=3 SV=1) HSP 1 Score: 103.6 bits (257), Expect = 3.8e-19 Identity = 58/77 (75.32%), Postives = 62/77 (80.52%), Query Frame = 0
BLAST of HG10011076 vs. ExPASy TrEMBL
Match: A0A1S3X2T9 (60S ribosomal protein L30-like OS=Nicotiana tabacum OX=4097 GN=LOC107760678 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 2.6e-15 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of HG10011076 vs. ExPASy TrEMBL
Match: A0A5D3CI16 (60S ribosomal protein L30 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold16G00350 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 2.6e-15 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of HG10011076 vs. ExPASy TrEMBL
Match: A0A6J1JJ11 (60S ribosomal protein L30-like OS=Cucurbita maxima OX=3661 GN=LOC111485536 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 2.6e-15 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of HG10011076 vs. ExPASy TrEMBL
Match: A0A0V0GYL7 (Putative ovule protein OS=Solanum chacoense OX=4108 PE=3 SV=1) HSP 1 Score: 90.9 bits (224), Expect = 2.6e-15 Identity = 48/49 (97.96%), Postives = 48/49 (97.96%), Query Frame = 0
BLAST of HG10011076 vs. TAIR 10
Match: AT1G36240.1 (Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein ) HSP 1 Score: 80.1 bits (196), Expect = 8.7e-16 Identity = 41/50 (82.00%), Postives = 48/50 (96.00%), Query Frame = 0
BLAST of HG10011076 vs. TAIR 10
Match: AT1G77940.1 (Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein ) HSP 1 Score: 77.8 bits (190), Expect = 4.3e-15 Identity = 40/50 (80.00%), Postives = 45/50 (90.00%), Query Frame = 0
BLAST of HG10011076 vs. TAIR 10
Match: AT3G18740.1 (Ribosomal protein L7Ae/L30e/S12e/Gadd45 family protein ) HSP 1 Score: 76.3 bits (186), Expect = 1.3e-14 Identity = 39/50 (78.00%), Postives = 46/50 (92.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|