HG10010346 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGGTGTTTGGGTGTTCAAAAACGGTGTCGTTCGGCTGGTGGAGAACGCCGGAGCCGATACGGCGGAGGGCGGTCAGCGGTCGAGACTACGGCGGAAAGTGTTGGTGTTCAGTTCGACGGCGGAGGTGATGACGTCATACGCAGTGTTGGAAGAGAAATTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCGAATCTGCTGCAATTCCACAAGAGATCGACGGTCCATCTTATTTCTCTCCCAAAAGACTTTGCCAAATTCAAATCCATGCATATGTACGACATCGTCGTCAAAAATCGAAATAATTTCGAAGTTAGAGATACCTAAATAAATTTAAAATAAAATTTTAAAAAATTATTTTAAAAAAATAGAAAAAATTTAAAAATAGAAAAATAAAGTAAACTATTTACACAAAATAGCAAAATATTTAGATAGTTTTGATAGATGCTGATAGAAGTCTATCAATGTCTATCACTATTTTCTTTGCTATTTTCTATAAATAGTTTGACATTTTTCTATTCGTGAAAATTTTCCTTAAAAAGATCTCCACTATTTTGTTTAAGTTTTTTTTATGCAATTTCTCGAGAAAAATTATTTGATGTGACTGTTACAATTTGTTGCGCAGCCAGAATCAATTGTTGGGTGTAAGTTCATATGTTTCGTGTGATTTAGATTTGTCAGTCATCTTGTTCTAA ATGGCGGGTGTTTGGGTGTTCAAAAACGGTGTCGTTCGGCTGGTGGAGAACGCCGGAGCCGATACGGCGGAGGGCGGTCAGCGGTCGAGACTACGGCGGAAAGTGTTGGTGTTCAGTTCGACGGCGGAGGTGATGACGTCATACGCAGTGTTGGAAGAGAAATTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCGAATCTGCTGCAATTCCACAAGAGATCGACGGTCCATCTTATTTCTCTCCCAAAAGACTTTGCCAAATTCAAATCCATGCATATCCAGAATCAATTGTTGGGTGTAAGTTCATATGTTTCGTGTGATTTAGATTTGTCAGTCATCTTGTTCTAA ATGGCGGGTGTTTGGGTGTTCAAAAACGGTGTCGTTCGGCTGGTGGAGAACGCCGGAGCCGATACGGCGGAGGGCGGTCAGCGGTCGAGACTACGGCGGAAAGTGTTGGTGTTCAGTTCGACGGCGGAGGTGATGACGTCATACGCAGTGTTGGAAGAGAAATTGATGACGTTGGGTTGGGAGCGTTATTACGATGATCCGAATCTGCTGCAATTCCACAAGAGATCGACGGTCCATCTTATTTCTCTCCCAAAAGACTTTGCCAAATTCAAATCCATGCATATCCAGAATCAATTGTTGGGTGTAAGTTCATATGTTTCGTGTGATTTAGATTTGTCAGTCATCTTGTTCTAA MAGVWVFKNGVVRLVENAGADTAEGGQRSRLRRKVLVFSSTAEVMTSYAVLEEKLMTLGWERYYDDPNLLQFHKRSTVHLISLPKDFAKFKSMHIQNQLLGVSSYVSCDLDLSVILF Homology
BLAST of HG10010346 vs. NCBI nr
Match: KAG7013634.1 (Flowering-promoting factor 1-like protein 3, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 183.0 bits (463), Expect = 1.5e-42 Identity = 88/95 (92.63%), Postives = 92/95 (96.84%), Query Frame = 0
BLAST of HG10010346 vs. NCBI nr
Match: XP_022959407.1 (flowering-promoting factor 1-like protein 3 [Cucurbita moschata] >KAG6575061.1 Flowering-promoting factor 1-like protein 3, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 183.0 bits (463), Expect = 1.5e-42 Identity = 88/95 (92.63%), Postives = 92/95 (96.84%), Query Frame = 0
BLAST of HG10010346 vs. NCBI nr
Match: XP_023006452.1 (flowering-promoting factor 1-like protein 3 [Cucurbita maxima] >XP_023549095.1 flowering-promoting factor 1-like protein 3 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 181.4 bits (459), Expect = 4.5e-42 Identity = 87/95 (91.58%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of HG10010346 vs. NCBI nr
Match: XP_038875612.1 (flowering-promoting factor 1-like protein 1 [Benincasa hispida]) HSP 1 Score: 166.4 bits (420), Expect = 1.5e-37 Identity = 80/96 (83.33%), Postives = 88/96 (91.67%), Query Frame = 0
BLAST of HG10010346 vs. NCBI nr
Match: XP_008458459.1 (PREDICTED: flowering-promoting factor 1-like protein 1 [Cucumis melo]) HSP 1 Score: 165.6 bits (418), Expect = 2.5e-37 Identity = 78/95 (82.11%), Postives = 87/95 (91.58%), Query Frame = 0
BLAST of HG10010346 vs. ExPASy Swiss-Prot
Match: Q0E1D7 (Flowering-promoting factor 1-like protein 3 OS=Oryza sativa subsp. japonica OX=39947 GN=Os02g0460200 PE=2 SV=1) HSP 1 Score: 115.5 bits (288), Expect = 3.9e-25 Identity = 58/97 (59.79%), Postives = 73/97 (75.26%), Query Frame = 0
BLAST of HG10010346 vs. ExPASy Swiss-Prot
Match: Q9LGE3 (Flowering-promoting factor 1-like protein 1 OS=Oryza sativa subsp. japonica OX=39947 GN=RAA1 PE=1 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 9.7e-24 Identity = 57/97 (58.76%), Postives = 71/97 (73.20%), Query Frame = 0
BLAST of HG10010346 vs. ExPASy Swiss-Prot
Match: O23624 (Flowering-promoting factor 1 OS=Arabidopsis thaliana OX=3702 GN=FPF1 PE=1 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.7e-23 Identity = 55/107 (51.40%), Postives = 79/107 (73.83%), Query Frame = 0
BLAST of HG10010346 vs. ExPASy Swiss-Prot
Match: O24340 (Flowering-promoting factor 1 OS=Sinapis alba OX=3728 GN=FPF1 PE=2 SV=1) HSP 1 Score: 110.2 bits (274), Expect = 1.7e-23 Identity = 56/107 (52.34%), Postives = 78/107 (72.90%), Query Frame = 0
BLAST of HG10010346 vs. ExPASy Swiss-Prot
Match: Q5Q0B3 (Flowering-promoting factor 1-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=FLP1 PE=2 SV=2) HSP 1 Score: 107.1 bits (266), Expect = 1.4e-22 Identity = 58/108 (53.70%), Postives = 78/108 (72.22%), Query Frame = 0
BLAST of HG10010346 vs. ExPASy TrEMBL
Match: A0A6J1H4F8 (flowering-promoting factor 1-like protein 3 OS=Cucurbita moschata OX=3662 GN=LOC111460392 PE=3 SV=1) HSP 1 Score: 183.0 bits (463), Expect = 7.4e-43 Identity = 88/95 (92.63%), Postives = 92/95 (96.84%), Query Frame = 0
BLAST of HG10010346 vs. ExPASy TrEMBL
Match: A0A6J1KVW8 (flowering-promoting factor 1-like protein 3 OS=Cucurbita maxima OX=3661 GN=LOC111499175 PE=3 SV=1) HSP 1 Score: 181.4 bits (459), Expect = 2.2e-42 Identity = 87/95 (91.58%), Postives = 91/95 (95.79%), Query Frame = 0
BLAST of HG10010346 vs. ExPASy TrEMBL
Match: A0A1S3C8H5 (flowering-promoting factor 1-like protein 1 OS=Cucumis melo OX=3656 GN=LOC103497861 PE=3 SV=1) HSP 1 Score: 165.6 bits (418), Expect = 1.2e-37 Identity = 78/95 (82.11%), Postives = 87/95 (91.58%), Query Frame = 0
BLAST of HG10010346 vs. ExPASy TrEMBL
Match: A0A0A0KCC2 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G194670 PE=3 SV=1) HSP 1 Score: 164.1 bits (414), Expect = 3.6e-37 Identity = 80/96 (83.33%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of HG10010346 vs. ExPASy TrEMBL
Match: A0A6J1ER18 (flowering-promoting factor 1-like protein 1 OS=Cucurbita moschata OX=3662 GN=LOC111436916 PE=3 SV=1) HSP 1 Score: 161.8 bits (408), Expect = 1.8e-36 Identity = 77/95 (81.05%), Postives = 85/95 (89.47%), Query Frame = 0
BLAST of HG10010346 vs. TAIR 10
Match: AT5G24860.1 (flowering promoting factor 1 ) HSP 1 Score: 110.2 bits (274), Expect = 1.2e-24 Identity = 55/107 (51.40%), Postives = 79/107 (73.83%), Query Frame = 0
BLAST of HG10010346 vs. TAIR 10
Match: AT4G31380.1 (FPF1-like protein 1 ) HSP 1 Score: 107.1 bits (266), Expect = 9.9e-24 Identity = 58/108 (53.70%), Postives = 78/108 (72.22%), Query Frame = 0
BLAST of HG10010346 vs. TAIR 10
Match: AT5G10625.1 (BEST Arabidopsis thaliana protein match is: flowering promoting factor 1 (TAIR:AT5G24860.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 101.7 bits (252), Expect = 4.2e-22 Identity = 51/96 (53.12%), Postives = 70/96 (72.92%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|