
HG10009599 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTCATCAACAGGTTGTTTCTCCACTAACATTGGTGTTGATTGGTCGTACAGGGAATGGAAAAAGTGCAACTGGAAACAGTATTCTTGGAAGAAGAGAATTCAAATCGAGGACAAGTTCTTCTGGCGTTACTAAATCTTCTGAGTTGCAATCCTGTGTGAGGAAAGATGGCCAGGTCATAAATGTGATCGATACACCCGGCAAGTAA ATGGTTCATCAACAGGTTGTTTCTCCACTAACATTGGTGTTGATTGGTCGTACAGGGAATGGAAAAAGTGCAACTGGAAACAGTATTCTTGGAAGAAGAGAATTCAAATCGAGGACAAGTTCTTCTGGCGTTACTAAATCTTCTGAGTTGCAATCCTGTGTGAGGAAAGATGGCCAGGTCATAAATGTGATCGATACACCCGGCAAGTAA ATGGTTCATCAACAGGTTGTTTCTCCACTAACATTGGTGTTGATTGGTCGTACAGGGAATGGAAAAAGTGCAACTGGAAACAGTATTCTTGGAAGAAGAGAATTCAAATCGAGGACAAGTTCTTCTGGCGTTACTAAATCTTCTGAGTTGCAATCCTGTGTGAGGAAAGATGGCCAGGTCATAAATGTGATCGATACACCCGGCAAGTAA MVHQQVVSPLTLVLIGRTGNGKSATGNSILGRREFKSRTSSSGVTKSSELQSCVRKDGQVINVIDTPGK Homology
BLAST of HG10009599 vs. NCBI nr
Match: XP_038907035.1 (immune-associated nucleotide-binding protein 9-like [Benincasa hispida] >XP_038907036.1 immune-associated nucleotide-binding protein 9-like [Benincasa hispida] >XP_038907037.1 immune-associated nucleotide-binding protein 9-like [Benincasa hispida]) HSP 1 Score: 121.3 bits (303), Expect = 3.2e-24 Identity = 61/68 (89.71%), Postives = 67/68 (98.53%), Query Frame = 0
BLAST of HG10009599 vs. NCBI nr
Match: XP_011654528.1 (immune-associated nucleotide-binding protein 9 [Cucumis sativus] >KGN49740.1 hypothetical protein Csa_017835 [Cucumis sativus]) HSP 1 Score: 112.8 bits (281), Expect = 1.1e-21 Identity = 59/63 (93.65%), Postives = 61/63 (96.83%), Query Frame = 0
BLAST of HG10009599 vs. NCBI nr
Match: XP_008466867.1 (PREDICTED: protein AIG1-like [Cucumis melo]) HSP 1 Score: 110.9 bits (276), Expect = 4.4e-21 Identity = 57/63 (90.48%), Postives = 61/63 (96.83%), Query Frame = 0
BLAST of HG10009599 vs. NCBI nr
Match: KAG6605257.1 (Immune-associated nucleotide-binding protein 9, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 110.5 bits (275), Expect = 5.7e-21 Identity = 56/68 (82.35%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of HG10009599 vs. NCBI nr
Match: XP_023533262.1 (immune-associated nucleotide-binding protein 9-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 110.5 bits (275), Expect = 5.7e-21 Identity = 56/68 (82.35%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of HG10009599 vs. ExPASy Swiss-Prot
Match: F4HT21 (Immune-associated nucleotide-binding protein 9 OS=Arabidopsis thaliana OX=3702 GN=IAN9 PE=2 SV=1) HSP 1 Score: 80.9 bits (198), Expect = 6.3e-15 Identity = 39/58 (67.24%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of HG10009599 vs. ExPASy Swiss-Prot
Match: Q9T0F3 (Immune-associated nucleotide-binding protein 12 OS=Arabidopsis thaliana OX=3702 GN=IAN12 PE=2 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 8.3e-15 Identity = 40/58 (68.97%), Postives = 49/58 (84.48%), Query Frame = 0
BLAST of HG10009599 vs. ExPASy Swiss-Prot
Match: Q9T0F2 (Immune-associated nucleotide-binding protein 11 OS=Arabidopsis thaliana OX=3702 GN=IAN11 PE=2 SV=1) HSP 1 Score: 72.0 bits (175), Expect = 2.9e-12 Identity = 38/58 (65.52%), Postives = 45/58 (77.59%), Query Frame = 0
BLAST of HG10009599 vs. ExPASy Swiss-Prot
Match: Q9C8V2 (Immune-associated nucleotide-binding protein 7 OS=Arabidopsis thaliana OX=3702 GN=IAN7 PE=2 SV=1) HSP 1 Score: 71.2 bits (173), Expect = 5.0e-12 Identity = 34/57 (59.65%), Postives = 43/57 (75.44%), Query Frame = 0
BLAST of HG10009599 vs. ExPASy Swiss-Prot
Match: O81025 (Immune-associated nucleotide-binding protein 10 OS=Arabidopsis thaliana OX=3702 GN=IAN10 PE=3 SV=1) HSP 1 Score: 70.1 bits (170), Expect = 1.1e-11 Identity = 32/57 (56.14%), Postives = 44/57 (77.19%), Query Frame = 0
BLAST of HG10009599 vs. ExPASy TrEMBL
Match: A0A0A0KJ27 (AIG1-type G domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_5G097460 PE=4 SV=1) HSP 1 Score: 112.8 bits (281), Expect = 5.6e-22 Identity = 59/63 (93.65%), Postives = 61/63 (96.83%), Query Frame = 0
BLAST of HG10009599 vs. ExPASy TrEMBL
Match: A0A1S3CS82 (protein AIG1-like OS=Cucumis melo OX=3656 GN=LOC103504177 PE=4 SV=1) HSP 1 Score: 110.9 bits (276), Expect = 2.1e-21 Identity = 57/63 (90.48%), Postives = 61/63 (96.83%), Query Frame = 0
BLAST of HG10009599 vs. ExPASy TrEMBL
Match: A0A6J1G8P1 (immune-associated nucleotide-binding protein 9-like OS=Cucurbita moschata OX=3662 GN=LOC111451835 PE=4 SV=1) HSP 1 Score: 109.8 bits (273), Expect = 4.7e-21 Identity = 56/68 (82.35%), Postives = 62/68 (91.18%), Query Frame = 0
BLAST of HG10009599 vs. ExPASy TrEMBL
Match: A0A6J1L1J6 (immune-associated nucleotide-binding protein 9-like OS=Cucurbita maxima OX=3661 GN=LOC111499569 PE=4 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 6.1e-21 Identity = 55/68 (80.88%), Postives = 63/68 (92.65%), Query Frame = 0
BLAST of HG10009599 vs. ExPASy TrEMBL
Match: A0A6J1CWK5 (immune-associated nucleotide-binding protein 9-like OS=Momordica charantia OX=3673 GN=LOC111015058 PE=4 SV=1) HSP 1 Score: 97.8 bits (242), Expect = 1.8e-17 Identity = 49/62 (79.03%), Postives = 56/62 (90.32%), Query Frame = 0
BLAST of HG10009599 vs. TAIR 10
Match: AT1G33970.1 (P-loop containing nucleoside triphosphate hydrolases superfamily protein ) HSP 1 Score: 80.9 bits (198), Expect = 4.5e-16 Identity = 39/58 (67.24%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of HG10009599 vs. TAIR 10
Match: AT1G33970.2 (P-loop containing nucleoside triphosphate hydrolases superfamily protein ) HSP 1 Score: 80.9 bits (198), Expect = 4.5e-16 Identity = 39/58 (67.24%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of HG10009599 vs. TAIR 10
Match: AT1G33970.3 (P-loop containing nucleoside triphosphate hydrolases superfamily protein ) HSP 1 Score: 80.9 bits (198), Expect = 4.5e-16 Identity = 39/58 (67.24%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of HG10009599 vs. TAIR 10
Match: AT1G33970.4 (P-loop containing nucleoside triphosphate hydrolases superfamily protein ) HSP 1 Score: 80.9 bits (198), Expect = 4.5e-16 Identity = 39/58 (67.24%), Postives = 48/58 (82.76%), Query Frame = 0
BLAST of HG10009599 vs. TAIR 10
Match: AT1G33970.5 (P-loop containing nucleoside triphosphate hydrolases superfamily protein ) HSP 1 Score: 80.9 bits (198), Expect = 4.5e-16 Identity = 39/58 (67.24%), Postives = 48/58 (82.76%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|