HG10007778 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTTTGTGTTGGGAAGCATTTGGAATGGAGAAGAATGGGCATCAGGTGGGAAGAAAGTGGATTGGTCTCAAGCACCATTTCAAGCAAATTACAAAGGCTTTGCCATTCTTGGCTGCCCATTTGGAAACCATTGTGATTCTCAGGCCTTTTTATGGAACAAAGCTGATACATGGCAACTAAATCCCACACAACAAAAGATGTATCAACTCGTCAAGACAAAATATGTGTATTATAGTTATTGTTCTAATCCAAATGCACGCCAACTATACAAAGAGTGTCAGTTTGAATAG ATGTTTGTGTTGGGAAGCATTTGGAATGGAGAAGAATGGGCATCAGGTGGGAAGAAAGTGGATTGGTCTCAAGCACCATTTCAAGCAAATTACAAAGGCTTTGCCATTCTTGGCTGCCCATTTGGAAACCATTGTGATTCTCAGGCCTTTTTATGGAACAAAGCTGATACATGGCAACTAAATCCCACACAACAAAAGATGTATCAACTCGTCAAGACAAAATATGTGTATTATAGTTATTGTTCTAATCCAAATGCACGCCAACTATACAAAGAGTGTCAGTTTGAATAG ATGTTTGTGTTGGGAAGCATTTGGAATGGAGAAGAATGGGCATCAGGTGGGAAGAAAGTGGATTGGTCTCAAGCACCATTTCAAGCAAATTACAAAGGCTTTGCCATTCTTGGCTGCCCATTTGGAAACCATTGTGATTCTCAGGCCTTTTTATGGAACAAAGCTGATACATGGCAACTAAATCCCACACAACAAAAGATGTATCAACTCGTCAAGACAAAATATGTGTATTATAGTTATTGTTCTAATCCAAATGCACGCCAACTATACAAAGAGTGTCAGTTTGAATAG MFVLGSIWNGEEWASGGKKVDWSQAPFQANYKGFAILGCPFGNHCDSQAFLWNKADTWQLNPTQQKMYQLVKTKYVYYSYCSNPNARQLYKECQFE Homology
BLAST of HG10007778 vs. NCBI nr
Match: XP_038877581.1 (LOW QUALITY PROTEIN: xyloglucan endotransglucosylase/hydrolase protein 2-like [Benincasa hispida]) HSP 1 Score: 200.3 bits (508), Expect = 7.6e-48 Identity = 88/96 (91.67%), Postives = 90/96 (93.75%), Query Frame = 0
BLAST of HG10007778 vs. NCBI nr
Match: KAE8653589.1 (hypothetical protein Csa_007107 [Cucumis sativus]) HSP 1 Score: 177.9 bits (450), Expect = 4.0e-41 Identity = 75/96 (78.12%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of HG10007778 vs. NCBI nr
Match: CCH26640.1 (putative xyloglucan endotransglucosylase/hydrolase [Cucumis sativus]) HSP 1 Score: 177.9 bits (450), Expect = 4.0e-41 Identity = 75/96 (78.12%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of HG10007778 vs. NCBI nr
Match: XP_022961348.1 (xyloglucan endotransglucosylase/hydrolase protein 2-like [Cucurbita moschata]) HSP 1 Score: 170.2 bits (430), Expect = 8.4e-39 Identity = 73/96 (76.04%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of HG10007778 vs. NCBI nr
Match: KAG7023744.1 (putative xyloglucan endotransglucosylase/hydrolase protein 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 170.2 bits (430), Expect = 8.4e-39 Identity = 73/96 (76.04%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of HG10007778 vs. ExPASy Swiss-Prot
Match: Q9SV61 (Putative xyloglucan endotransglucosylase/hydrolase protein 1 OS=Arabidopsis thaliana OX=3702 GN=XTH1 PE=3 SV=3) HSP 1 Score: 80.9 bits (198), Expect = 8.8e-15 Identity = 41/88 (46.59%), Postives = 57/88 (64.77%), Query Frame = 0
BLAST of HG10007778 vs. ExPASy Swiss-Prot
Match: Q9SV60 (Xyloglucan endotransglucosylase/hydrolase protein 2 OS=Arabidopsis thaliana OX=3702 GN=XTH2 PE=2 SV=1) HSP 1 Score: 78.2 bits (191), Expect = 5.7e-14 Identity = 39/91 (42.86%), Postives = 56/91 (61.54%), Query Frame = 0
BLAST of HG10007778 vs. ExPASy Swiss-Prot
Match: Q9LJR7 (Xyloglucan endotransglucosylase/hydrolase protein 3 OS=Arabidopsis thaliana OX=3702 GN=XTH3 PE=2 SV=1) HSP 1 Score: 77.4 bits (189), Expect = 9.7e-14 Identity = 35/96 (36.46%), Postives = 59/96 (61.46%), Query Frame = 0
BLAST of HG10007778 vs. ExPASy Swiss-Prot
Match: Q41638 (Xyloglucan endotransglucosylase/hydrolase protein A OS=Phaseolus angularis OX=3914 GN=XTHA PE=1 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.7e-11 Identity = 34/89 (38.20%), Postives = 52/89 (58.43%), Query Frame = 0
BLAST of HG10007778 vs. ExPASy Swiss-Prot
Match: Q39857 (Xyloglucan endotransglucosylase/hydrolase 1 OS=Glycine max OX=3847 GN=XTH1 PE=2 SV=2) HSP 1 Score: 67.4 bits (163), Expect = 1.0e-10 Identity = 34/89 (38.20%), Postives = 52/89 (58.43%), Query Frame = 0
BLAST of HG10007778 vs. ExPASy TrEMBL
Match: N0DX90 (Putative xyloglucan endotransglucosylase/hydrolase OS=Cucumis sativus OX=3659 GN=xth30 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 2.0e-41 Identity = 75/96 (78.12%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of HG10007778 vs. ExPASy TrEMBL
Match: A0A0A0M0Q5 (GH16 domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_1G662760 PE=4 SV=1) HSP 1 Score: 177.9 bits (450), Expect = 2.0e-41 Identity = 75/96 (78.12%), Postives = 87/96 (90.62%), Query Frame = 0
BLAST of HG10007778 vs. ExPASy TrEMBL
Match: A0A6J1JA91 (xyloglucan endotransglucosylase/hydrolase protein 2-like OS=Cucurbita maxima OX=3661 GN=LOC111484959 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 4.1e-39 Identity = 73/96 (76.04%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of HG10007778 vs. ExPASy TrEMBL
Match: A0A6J1HBJ0 (xyloglucan endotransglucosylase/hydrolase protein 2-like OS=Cucurbita moschata OX=3662 GN=LOC111461864 PE=4 SV=1) HSP 1 Score: 170.2 bits (430), Expect = 4.1e-39 Identity = 73/96 (76.04%), Postives = 79/96 (82.29%), Query Frame = 0
BLAST of HG10007778 vs. ExPASy TrEMBL
Match: N0DX41 (Putative xyloglucan endotransglucosylase/hydrolase OS=Cucumis sativus OX=3659 GN=xth26 PE=4 SV=1) HSP 1 Score: 136.0 bits (341), Expect = 8.5e-29 Identity = 60/93 (64.52%), Postives = 67/93 (72.04%), Query Frame = 0
BLAST of HG10007778 vs. TAIR 10
Match: AT4G13080.1 (xyloglucan endotransglucosylase/hydrolase 1 ) HSP 1 Score: 80.9 bits (198), Expect = 6.3e-16 Identity = 41/88 (46.59%), Postives = 57/88 (64.77%), Query Frame = 0
BLAST of HG10007778 vs. TAIR 10
Match: AT4G13090.1 (xyloglucan endotransglucosylase/hydrolase 2 ) HSP 1 Score: 78.2 bits (191), Expect = 4.1e-15 Identity = 39/91 (42.86%), Postives = 56/91 (61.54%), Query Frame = 0
BLAST of HG10007778 vs. TAIR 10
Match: AT3G25050.1 (xyloglucan endotransglucosylase/hydrolase 3 ) HSP 1 Score: 77.4 bits (189), Expect = 6.9e-15 Identity = 35/96 (36.46%), Postives = 59/96 (61.46%), Query Frame = 0
BLAST of HG10007778 vs. TAIR 10
Match: AT4G37800.1 (xyloglucan endotransglucosylase/hydrolase 7 ) HSP 1 Score: 65.9 bits (159), Expect = 2.1e-11 Identity = 31/88 (35.23%), Postives = 50/88 (56.82%), Query Frame = 0
BLAST of HG10007778 vs. TAIR 10
Match: AT5G65730.1 (xyloglucan endotransglucosylase/hydrolase 6 ) HSP 1 Score: 65.5 bits (158), Expect = 2.7e-11 Identity = 32/88 (36.36%), Postives = 50/88 (56.82%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|