
HG10005959 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: polypeptideCDS Hold the cursor over a type above to highlight its positions in the sequence below.ATGGATGCTTTTAGAAGGCAACTGGACCAGCTAATGGGTGCGAATCGAAATGGCGACGTGCAGGAGGTTAGCCGCAAGTACTACGACCGCGATGTGTGCCGCATGTTCTTAGTTGGGCTTTGTCCCCATGAGCTCTTCCAACTCACGGTTAGATCAATTCAATCTTTCCTTCATTTCCCACCTCGTCTTTTGTTTAGGGACACTTTTTTTAGTCAGAACACCGCCCGGCAACTGTTCTGGAGCTTTCTTTGCTGGTTATTGAGTTTTTGTTGGTTTAGTTGTTAGGAAAAATCTGGGTGGTCAACCGTCTGTAAATGGAAGGGTGGAGGGAAAAATGCCGAGCATAATTTGTTTTTTTGTTGTGGGAAATTGATTTCTGCTATCAACTATTTGGGTTTTTTCTTCTTCTTTTTGTTAATACATTAATTTATTTTTACAATATTTTAATTAAATTCATTTTTCTGTTTCAGAAAATGGATATGGGTCCTTGTCCGAAGATCCACTCCTTGCAACTTAGGAAAGAGTATCCTTGA ATGGATGCTTTTAGAAGGCAACTGGACCAGCTAATGGGTGCGAATCGAAATGGCGACGTGCAGGAGGTTAGCCGCAAGTACTACGACCGCGATGTGTGCCGCATGTTCTTAGTTGGGCTTTGTCCCCATGAGCTCTTCCAACTCACGAAAATGGATATGGGTCCTTGTCCGAAGATCCACTCCTTGCAACTTAGGAAAGAGTATCCTTGA ATGGATGCTTTTAGAAGGCAACTGGACCAGCTAATGGGTGCGAATCGAAATGGCGACGTGCAGGAGGTTAGCCGCAAGTACTACGACCGCGATGTGTGCCGCATGTTCTTAGTTGGGCTTTGTCCCCATGAGCTCTTCCAACTCACGAAAATGGATATGGGTCCTTGTCCGAAGATCCACTCCTTGCAACTTAGGAAAGAGTATCCTTGA MDAFRRQLDQLMGANRNGDVQEVSRKYYDRDVCRMFLVGLCPHELFQLTKMDMGPCPKIHSLQLRKEYP Homology
BLAST of HG10005959 vs. NCBI nr
Match: KAG7036822.1 (putative RNA-binding protein Luc7-like 1, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 148.3 bits (373), Expect = 2.5e-32 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10005959 vs. NCBI nr
Match: XP_038889987.1 (putative RNA-binding protein Luc7-like 2 isoform X2 [Benincasa hispida] >XP_038889988.1 putative RNA-binding protein Luc7-like 2 isoform X2 [Benincasa hispida] >XP_038889989.1 putative RNA-binding protein Luc7-like 2 isoform X2 [Benincasa hispida]) HSP 1 Score: 148.3 bits (373), Expect = 2.5e-32 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10005959 vs. NCBI nr
Match: XP_022998948.1 (putative RNA-binding protein Luc7-like 2 [Cucurbita maxima]) HSP 1 Score: 148.3 bits (373), Expect = 2.5e-32 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10005959 vs. NCBI nr
Match: XP_031736790.1 (putative RNA-binding protein Luc7-like 2 isoform X3 [Cucumis sativus]) HSP 1 Score: 148.3 bits (373), Expect = 2.5e-32 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10005959 vs. NCBI nr
Match: XP_038889990.1 (putative RNA-binding protein Luc7-like 2 isoform X3 [Benincasa hispida]) HSP 1 Score: 148.3 bits (373), Expect = 2.5e-32 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10005959 vs. ExPASy Swiss-Prot
Match: Q9USM4 (U1 snRNP-associated protein usp106 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=usp106 PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 1.6e-13 Identity = 32/64 (50.00%), Postives = 45/64 (70.31%), Query Frame = 0
BLAST of HG10005959 vs. ExPASy Swiss-Prot
Match: Q54XQ8 (Luc7-like protein OS=Dictyostelium discoideum OX=44689 GN=crop PE=3 SV=1) HSP 1 Score: 68.9 bits (167), Expect = 2.5e-11 Identity = 33/72 (45.83%), Postives = 44/72 (61.11%), Query Frame = 0
BLAST of HG10005959 vs. ExPASy Swiss-Prot
Match: Q9Y383 (Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2 PE=1 SV=2) HSP 1 Score: 68.2 bits (165), Expect = 4.2e-11 Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 0
BLAST of HG10005959 vs. ExPASy Swiss-Prot
Match: Q7TNC4 (Putative RNA-binding protein Luc7-like 2 OS=Mus musculus OX=10090 GN=Luc7l2 PE=1 SV=1) HSP 1 Score: 68.2 bits (165), Expect = 4.2e-11 Identity = 29/64 (45.31%), Postives = 40/64 (62.50%), Query Frame = 0
BLAST of HG10005959 vs. ExPASy Swiss-Prot
Match: Q9NQ29 (Putative RNA-binding protein Luc7-like 1 OS=Homo sapiens OX=9606 GN=LUC7L PE=1 SV=1) HSP 1 Score: 66.2 bits (160), Expect = 1.6e-10 Identity = 30/64 (46.88%), Postives = 39/64 (60.94%), Query Frame = 0
BLAST of HG10005959 vs. ExPASy TrEMBL
Match: A0A6J1KI81 (putative RNA-binding protein Luc7-like 2 OS=Cucurbita maxima OX=3661 GN=LOC111493454 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 1.2e-32 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10005959 vs. ExPASy TrEMBL
Match: A0A5D3DFM5 (Putative RNA-binding protein Luc7-like 2 isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold333G00620 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 1.2e-32 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10005959 vs. ExPASy TrEMBL
Match: A0A5A7SSI6 (Putative RNA-binding protein Luc7-like 2 isoform X1 OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold219G00100 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 1.2e-32 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10005959 vs. ExPASy TrEMBL
Match: A0A0A0LKT3 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G099460 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 1.2e-32 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10005959 vs. ExPASy TrEMBL
Match: A0A6J1CRX6 (putative RNA-binding protein Luc7-like 2 isoform X1 OS=Momordica charantia OX=3673 GN=LOC111014201 PE=3 SV=1) HSP 1 Score: 148.3 bits (373), Expect = 1.2e-32 Identity = 68/68 (100.00%), Postives = 68/68 (100.00%), Query Frame = 0
BLAST of HG10005959 vs. TAIR 10
Match: AT3G03340.1 (LUC7 related protein ) HSP 1 Score: 134.8 bits (338), Expect = 2.6e-32 Identity = 59/68 (86.76%), Postives = 65/68 (95.59%), Query Frame = 0
BLAST of HG10005959 vs. TAIR 10
Match: AT5G17440.1 (LUC7 related protein ) HSP 1 Score: 133.7 bits (335), Expect = 5.8e-32 Identity = 59/68 (86.76%), Postives = 64/68 (94.12%), Query Frame = 0
BLAST of HG10005959 vs. TAIR 10
Match: AT5G51410.1 (LUC7 N_terminus domain-containing protein ) HSP 1 Score: 65.1 bits (157), Expect = 2.6e-11 Identity = 32/72 (44.44%), Postives = 45/72 (62.50%), Query Frame = 0
BLAST of HG10005959 vs. TAIR 10
Match: AT5G51410.2 (LUC7 N_terminus domain-containing protein ) HSP 1 Score: 65.1 bits (157), Expect = 2.6e-11 Identity = 32/72 (44.44%), Postives = 45/72 (62.50%), Query Frame = 0
BLAST of HG10005959 vs. TAIR 10
Match: AT5G51410.3 (LUC7 N_terminus domain-containing protein ) HSP 1 Score: 65.1 bits (157), Expect = 2.6e-11 Identity = 32/72 (44.44%), Postives = 45/72 (62.50%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|