HG10005901 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGCATAGAGGAACTAGCAAAGTGATATCAGTGGCGACAACAAATGCAAAAGATCTTAGAAACAGTCTACCATCACTTACAGATCACAATGCATGTAGAGTAATAGGGAAGCTTATTGCAGAGAGATCAAAGGAAGCAGATGTATATGCAATTTCATATGAGCCTAGGAAGGATGAAAGAATTGAAGGTAAACTTGGTATTGTTATTGATACCATTAAGGAGAATGGGATCATGTTTGTACCTTGA ATGCATAGAGGAACTAGCAAAGTGATATCAGTGGCGACAACAAATGCAAAAGATCTTAGAAACAGTCTACCATCACTTACAGATCACAATGCATGTAGAGTAATAGGGAAGCTTATTGCAGAGAGATCAAAGGAAGCAGATGTATATGCAATTTCATATGAGCCTAGGAAGGATGAAAGAATTGAAGGTAAACTTGGTATTGTTATTGATACCATTAAGGAGAATGGGATCATGTTTGTACCTTGA ATGCATAGAGGAACTAGCAAAGTGATATCAGTGGCGACAACAAATGCAAAAGATCTTAGAAACAGTCTACCATCACTTACAGATCACAATGCATGTAGAGTAATAGGGAAGCTTATTGCAGAGAGATCAAAGGAAGCAGATGTATATGCAATTTCATATGAGCCTAGGAAGGATGAAAGAATTGAAGGTAAACTTGGTATTGTTATTGATACCATTAAGGAGAATGGGATCATGTTTGTACCTTGA MHRGTSKVISVATTNAKDLRNSLPSLTDHNACRVIGKLIAERSKEADVYAISYEPRKDERIEGKLGIVIDTIKENGIMFVP Homology
BLAST of HG10005901 vs. NCBI nr
Match: XP_022993255.1 (uncharacterized protein LOC111489327 [Cucurbita maxima]) HSP 1 Score: 160.6 bits (405), Expect = 5.6e-36 Identity = 80/81 (98.77%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of HG10005901 vs. NCBI nr
Match: XP_023521951.1 (uncharacterized protein LOC111785799 [Cucurbita pepo subsp. pepo]) HSP 1 Score: 160.6 bits (405), Expect = 5.6e-36 Identity = 80/81 (98.77%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of HG10005901 vs. NCBI nr
Match: XP_022990182.1 (uncharacterized protein LOC111487153 [Cucurbita maxima]) HSP 1 Score: 160.6 bits (405), Expect = 5.6e-36 Identity = 80/81 (98.77%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of HG10005901 vs. NCBI nr
Match: XP_008441144.1 (PREDICTED: 50S ribosomal protein L18-like [Cucumis melo]) HSP 1 Score: 160.6 bits (405), Expect = 5.6e-36 Identity = 80/81 (98.77%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of HG10005901 vs. NCBI nr
Match: XP_022152485.1 (uncharacterized protein LOC111020202 [Momordica charantia]) HSP 1 Score: 160.2 bits (404), Expect = 7.4e-36 Identity = 79/81 (97.53%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of HG10005901 vs. ExPASy Swiss-Prot
Match: Q5P316 (50S ribosomal protein L18 OS=Aromatoleum aromaticum (strain EbN1) OX=76114 GN=rplR PE=3 SV=1) HSP 1 Score: 50.4 bits (119), Expect = 1.1e-05 Identity = 26/74 (35.14%), Postives = 48/74 (64.86%), Query Frame = 0
BLAST of HG10005901 vs. ExPASy Swiss-Prot
Match: Q8PNR1 (50S ribosomal protein L18 OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=rplR PE=3 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 7.0e-05 Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 0
BLAST of HG10005901 vs. ExPASy Swiss-Prot
Match: Q3BWW7 (50S ribosomal protein L18 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) OX=316273 GN=rplR PE=3 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 7.0e-05 Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 0
BLAST of HG10005901 vs. ExPASy Swiss-Prot
Match: B1XSR7 (50S ribosomal protein L18 OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) OX=452638 GN=rplR PE=3 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.2e-04 Identity = 24/74 (32.43%), Postives = 46/74 (62.16%), Query Frame = 0
BLAST of HG10005901 vs. ExPASy Swiss-Prot
Match: Q4URF5 (50S ribosomal protein L18 OS=Xanthomonas campestris pv. campestris (strain 8004) OX=314565 GN=rplR PE=3 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.2e-04 Identity = 25/74 (33.78%), Postives = 44/74 (59.46%), Query Frame = 0
BLAST of HG10005901 vs. ExPASy TrEMBL
Match: A0A6J1JHY7 (uncharacterized protein LOC111487153 OS=Cucurbita maxima OX=3661 GN=LOC111487153 PE=4 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 2.7e-36 Identity = 80/81 (98.77%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of HG10005901 vs. ExPASy TrEMBL
Match: A0A6J1JY30 (uncharacterized protein LOC111489327 OS=Cucurbita maxima OX=3661 GN=LOC111489327 PE=4 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 2.7e-36 Identity = 80/81 (98.77%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of HG10005901 vs. ExPASy TrEMBL
Match: A0A1S3B2Q8 (50S ribosomal protein L18-like OS=Cucumis melo OX=3656 GN=LOC103485371 PE=4 SV=1) HSP 1 Score: 160.6 bits (405), Expect = 2.7e-36 Identity = 80/81 (98.77%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of HG10005901 vs. ExPASy TrEMBL
Match: A0A6J1DE20 (uncharacterized protein LOC111020202 OS=Momordica charantia OX=3673 GN=LOC111020202 PE=4 SV=1) HSP 1 Score: 160.2 bits (404), Expect = 3.6e-36 Identity = 79/81 (97.53%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of HG10005901 vs. ExPASy TrEMBL
Match: A0A6J1FFK7 (uncharacterized protein LOC111445279 OS=Cucurbita moschata OX=3662 GN=LOC111445279 PE=4 SV=1) HSP 1 Score: 159.5 bits (402), Expect = 6.1e-36 Identity = 79/81 (97.53%), Postives = 81/81 (100.00%), Query Frame = 0
BLAST of HG10005901 vs. TAIR 10
Match: AT3G20230.1 (Ribosomal L18p/L5e family protein ) HSP 1 Score: 135.6 bits (340), Expect = 1.8e-32 Identity = 66/81 (81.48%), Postives = 75/81 (92.59%), Query Frame = 0
BLAST of HG10005901 vs. TAIR 10
Match: AT1G08845.1 (Ribosomal L18p/L5e family protein ) HSP 1 Score: 74.7 bits (182), Expect = 3.8e-14 Identity = 35/76 (46.05%), Postives = 53/76 (69.74%), Query Frame = 0
BLAST of HG10005901 vs. TAIR 10
Match: AT1G08845.2 (Ribosomal L18p/L5e family protein ) HSP 1 Score: 74.7 bits (182), Expect = 3.8e-14 Identity = 35/76 (46.05%), Postives = 53/76 (69.74%), Query Frame = 0
BLAST of HG10005901 vs. TAIR 10
Match: AT3G22450.1 (Ribosomal L18p/L5e family protein ) HSP 1 Score: 70.1 bits (170), Expect = 9.3e-13 Identity = 32/77 (41.56%), Postives = 54/77 (70.13%), Query Frame = 0
BLAST of HG10005901 vs. TAIR 10
Match: AT5G27820.1 (Ribosomal L18p/L5e family protein ) HSP 1 Score: 50.1 bits (118), Expect = 1.0e-06 Identity = 25/77 (32.47%), Postives = 45/77 (58.44%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|