HG10005841 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCATACGACGACGTGGAGATTGAAGACATGGAGTGGAACGAGGAACTGCAGGCCTTCACGTACCCTTGCCCCTGCGGCGACTTATTCCAGATCACCAAGGAGGATCTTAAGCTCGGCGAAGAGATTGCTCGGTGCCCTAGCTGCTCTCTTTACATCACAGTCATCTACAACATGGAAGATTTTCTCGGAGACTCTAATCAGAAGAATAACAAAGGACTTGAGCCCTCTAAACAGCAGCCTATCGTCGTCGCTTAA ATGTCATACGACGACGTGGAGATTGAAGACATGGAGTGGAACGAGGAACTGCAGGCCTTCACGTACCCTTGCCCCTGCGGCGACTTATTCCAGATCACCAAGGAGGATCTTAAGCTCGGCGAAGAGATTGCTCGGTGCCCTAGCTGCTCTCTTTACATCACAGTCATCTACAACATGGAAGATTTTCTCGGAGACTCTAATCAGAAGAATAACAAAGGACTTGAGCCCTCTAAACAGCAGCCTATCGTCGTCGCTTAA ATGTCATACGACGACGTGGAGATTGAAGACATGGAGTGGAACGAGGAACTGCAGGCCTTCACGTACCCTTGCCCCTGCGGCGACTTATTCCAGATCACCAAGGAGGATCTTAAGCTCGGCGAAGAGATTGCTCGGTGCCCTAGCTGCTCTCTTTACATCACAGTCATCTACAACATGGAAGATTTTCTCGGAGACTCTAATCAGAAGAATAACAAAGGACTTGAGCCCTCTAAACAGCAGCCTATCGTCGTCGCTTAA MSYDDVEIEDMEWNEELQAFTYPCPCGDLFQITKEDLKLGEEIARCPSCSLYITVIYNMEDFLGDSNQKNNKGLEPSKQQPIVVA Homology
BLAST of HG10005841 vs. NCBI nr
Match: XP_038887330.1 (diphthamide biosynthesis protein 3-like [Benincasa hispida] >XP_038887331.1 diphthamide biosynthesis protein 3-like [Benincasa hispida]) HSP 1 Score: 184.9 bits (468), Expect = 2.9e-43 Identity = 85/85 (100.00%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of HG10005841 vs. NCBI nr
Match: XP_022972367.1 (diphthamide biosynthesis protein 3-like [Cucurbita maxima]) HSP 1 Score: 179.9 bits (455), Expect = 9.4e-42 Identity = 82/85 (96.47%), Postives = 84/85 (98.82%), Query Frame = 0
BLAST of HG10005841 vs. NCBI nr
Match: XP_008454889.1 (PREDICTED: diphthamide biosynthesis protein 3-like [Cucumis melo] >XP_008454890.1 PREDICTED: diphthamide biosynthesis protein 3-like [Cucumis melo] >KAA0031262.1 diphthamide biosynthesis protein 3-like [Cucumis melo var. makuwa] >TYK06714.1 diphthamide biosynthesis protein 3-like [Cucumis melo var. makuwa]) HSP 1 Score: 179.1 bits (453), Expect = 1.6e-41 Identity = 82/85 (96.47%), Postives = 83/85 (97.65%), Query Frame = 0
BLAST of HG10005841 vs. NCBI nr
Match: XP_022136247.1 (diphthamide biosynthesis protein 3-like [Momordica charantia]) HSP 1 Score: 177.6 bits (449), Expect = 4.7e-41 Identity = 79/85 (92.94%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of HG10005841 vs. NCBI nr
Match: XP_004137002.1 (diphthamide biosynthesis protein 3 [Cucumis sativus] >KGN43974.1 hypothetical protein Csa_017712 [Cucumis sativus]) HSP 1 Score: 176.4 bits (446), Expect = 1.0e-40 Identity = 81/85 (95.29%), Postives = 82/85 (96.47%), Query Frame = 0
BLAST of HG10005841 vs. ExPASy Swiss-Prot
Match: Q21102 (DPH3 homolog OS=Caenorhabditis elegans OX=6239 GN=K01H12.1 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.7e-17 Identity = 36/61 (59.02%), Postives = 50/61 (81.97%), Query Frame = 0
BLAST of HG10005841 vs. ExPASy Swiss-Prot
Match: Q9VGQ9 (DPH3 homolog OS=Drosophila melanogaster OX=7227 GN=CG14701 PE=3 SV=1) HSP 1 Score: 89.7 bits (221), Expect = 1.7e-17 Identity = 38/68 (55.88%), Postives = 53/68 (77.94%), Query Frame = 0
BLAST of HG10005841 vs. ExPASy Swiss-Prot
Match: Q6VUC1 (DPH3 homolog OS=Cricetulus griseus OX=10029 GN=DPH3 PE=3 SV=1) HSP 1 Score: 89.0 bits (219), Expect = 2.9e-17 Identity = 35/61 (57.38%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of HG10005841 vs. ExPASy Swiss-Prot
Match: Q96FX2 (DPH3 homolog OS=Homo sapiens OX=9606 GN=DPH3 PE=1 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.7e-17 Identity = 35/61 (57.38%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of HG10005841 vs. ExPASy Swiss-Prot
Match: Q4R312 (DPH3 homolog OS=Macaca fascicularis OX=9541 GN=DPH3 PE=3 SV=1) HSP 1 Score: 88.6 bits (218), Expect = 3.7e-17 Identity = 35/61 (57.38%), Postives = 49/61 (80.33%), Query Frame = 0
BLAST of HG10005841 vs. ExPASy TrEMBL
Match: A0A6J1I4L9 (diphthamide biosynthesis protein 3-like OS=Cucurbita maxima OX=3661 GN=LOC111470942 PE=4 SV=1) HSP 1 Score: 179.9 bits (455), Expect = 4.6e-42 Identity = 82/85 (96.47%), Postives = 84/85 (98.82%), Query Frame = 0
BLAST of HG10005841 vs. ExPASy TrEMBL
Match: A0A1S3BZL5 (diphthamide biosynthesis protein 3-like OS=Cucumis melo OX=3656 GN=LOC103495198 PE=4 SV=1) HSP 1 Score: 179.1 bits (453), Expect = 7.8e-42 Identity = 82/85 (96.47%), Postives = 83/85 (97.65%), Query Frame = 0
BLAST of HG10005841 vs. ExPASy TrEMBL
Match: A0A5A7SJN1 (Diphthamide biosynthesis protein 3-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold13G00150 PE=4 SV=1) HSP 1 Score: 179.1 bits (453), Expect = 7.8e-42 Identity = 82/85 (96.47%), Postives = 83/85 (97.65%), Query Frame = 0
BLAST of HG10005841 vs. ExPASy TrEMBL
Match: A0A6J1C519 (diphthamide biosynthesis protein 3-like OS=Momordica charantia OX=3673 GN=LOC111007992 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 2.3e-41 Identity = 79/85 (92.94%), Postives = 85/85 (100.00%), Query Frame = 0
BLAST of HG10005841 vs. ExPASy TrEMBL
Match: A0A0A0K4W9 (DPH-type MB domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_7G075060 PE=4 SV=1) HSP 1 Score: 176.4 bits (446), Expect = 5.0e-41 Identity = 81/85 (95.29%), Postives = 82/85 (96.47%), Query Frame = 0
BLAST of HG10005841 vs. TAIR 10
Match: AT2G15910.2 (CSL zinc finger domain-containing protein ) HSP 1 Score: 145.2 bits (365), Expect = 2.4e-35 Identity = 67/85 (78.82%), Postives = 74/85 (87.06%), Query Frame = 0
BLAST of HG10005841 vs. TAIR 10
Match: AT2G15910.1 (CSL zinc finger domain-containing protein ) HSP 1 Score: 141.4 bits (355), Expect = 3.5e-34 Identity = 65/82 (79.27%), Postives = 72/82 (87.80%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|