HG10005291 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCGTTACAGAAAGTGACGGTAACCGGGTGGGCGGAGCAAAAGAGGGTACTGAGAGCGGCTAGAAAAAACGGTCGTCGGGCGGAGCTGTGGCAGTTACCCTACAACCCGGACCACGATAACTGCAGTGATCCCTATCCTCAGCATCAATTAAATGGGCCGATTCAAAATTTTTATGGGCCTCAGCCCAGTTCAACTTACAACTATTACAAACATGGGTACGATAGTCACGATCAGGCCCAACATCTTAACTACTCCACACATTCCAACATCTTCGGCCGCCAGACTGGTTCCATGTTTAGTGACGAAAATGTCAATAATTGCTCTATTATGTGA ATGTCGTTACAGAAAGTGACGGTAACCGGGTGGGCGGAGCAAAAGAGGGTACTGAGAGCGGCTAGAAAAAACGGTCGTCGGGCGGAGCTGTGGCAGTTACCCTACAACCCGGACCACGATAACTGCAGTGATCCCTATCCTCAGCATCAATTAAATGGGCCGATTCAAAATTTTTATGGGCCTCAGCCCAGTTCAACTTACAACTATTACAAACATGGGTACGATAGTCACGATCAGGCCCAACATCTTAACTACTCCACACATTCCAACATCTTCGGCCGCCAGACTGGTTCCATGTTTAGTGACGAAAATGTCAATAATTGCTCTATTATGTGA ATGTCGTTACAGAAAGTGACGGTAACCGGGTGGGCGGAGCAAAAGAGGGTACTGAGAGCGGCTAGAAAAAACGGTCGTCGGGCGGAGCTGTGGCAGTTACCCTACAACCCGGACCACGATAACTGCAGTGATCCCTATCCTCAGCATCAATTAAATGGGCCGATTCAAAATTTTTATGGGCCTCAGCCCAGTTCAACTTACAACTATTACAAACATGGGTACGATAGTCACGATCAGGCCCAACATCTTAACTACTCCACACATTCCAACATCTTCGGCCGCCAGACTGGTTCCATGTTTAGTGACGAAAATGTCAATAATTGCTCTATTATGTGA MSLQKVTVTGWAEQKRVLRAARKNGRRAELWQLPYNPDHDNCSDPYPQHQLNGPIQNFYGPQPSSTYNYYKHGYDSHDQAQHLNYSTHSNIFGRQTGSMFSDENVNNCSIM Homology
BLAST of HG10005291 vs. NCBI nr
Match: XP_038887235.1 (heavy metal-associated isoprenylated plant protein 28 [Benincasa hispida]) HSP 1 Score: 224.6 bits (571), Expect = 4.4e-55 Identity = 104/111 (93.69%), Postives = 108/111 (97.30%), Query Frame = 0
BLAST of HG10005291 vs. NCBI nr
Match: XP_004137028.1 (heavy metal-associated isoprenylated plant protein 28 [Cucumis sativus] >KGN43626.1 hypothetical protein Csa_017235 [Cucumis sativus]) HSP 1 Score: 223.4 bits (568), Expect = 9.7e-55 Identity = 103/111 (92.79%), Postives = 108/111 (97.30%), Query Frame = 0
BLAST of HG10005291 vs. NCBI nr
Match: XP_008455305.1 (PREDICTED: heavy metal-associated isoprenylated plant protein 20 [Cucumis melo] >KAA0031565.1 heavy metal-associated isoprenylated plant protein 20 [Cucumis melo var. makuwa] >TYK07016.1 heavy metal-associated isoprenylated plant protein 20 [Cucumis melo var. makuwa]) HSP 1 Score: 223.0 bits (567), Expect = 1.3e-54 Identity = 103/111 (92.79%), Postives = 109/111 (98.20%), Query Frame = 0
BLAST of HG10005291 vs. NCBI nr
Match: XP_022148017.1 (heavy metal-associated isoprenylated plant protein 28 [Momordica charantia]) HSP 1 Score: 216.5 bits (550), Expect = 1.2e-52 Identity = 99/111 (89.19%), Postives = 107/111 (96.40%), Query Frame = 0
BLAST of HG10005291 vs. NCBI nr
Match: KAG6572399.1 (Heavy metal-associated isoprenylated plant protein 28, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 207.2 bits (526), Expect = 7.2e-50 Identity = 94/111 (84.68%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of HG10005291 vs. ExPASy Swiss-Prot
Match: F4IC29 (Heavy metal-associated isoprenylated plant protein 28 OS=Arabidopsis thaliana OX=3702 GN=HIPP28 PE=3 SV=1) HSP 1 Score: 127.1 bits (318), Expect = 1.2e-28 Identity = 68/116 (58.62%), Postives = 81/116 (69.83%), Query Frame = 0
BLAST of HG10005291 vs. ExPASy Swiss-Prot
Match: Q9LP41 (Heavy metal-associated isoprenylated plant protein 29 OS=Arabidopsis thaliana OX=3702 GN=HIPP29 PE=3 SV=1) HSP 1 Score: 70.5 bits (171), Expect = 1.4e-11 Identity = 43/109 (39.45%), Postives = 62/109 (56.88%), Query Frame = 0
BLAST of HG10005291 vs. ExPASy Swiss-Prot
Match: F4IQG4 (Heavy metal-associated isoprenylated plant protein 30 OS=Arabidopsis thaliana OX=3702 GN=HIPP30 PE=1 SV=1) HSP 1 Score: 63.9 bits (154), Expect = 1.3e-09 Identity = 36/111 (32.43%), Postives = 63/111 (56.76%), Query Frame = 0
BLAST of HG10005291 vs. ExPASy Swiss-Prot
Match: F4JMB8 (Heavy metal-associated isoprenylated plant protein 44 OS=Arabidopsis thaliana OX=3702 GN=HIPP44 PE=2 SV=1) HSP 1 Score: 50.8 bits (120), Expect = 1.1e-05 Identity = 35/113 (30.97%), Postives = 57/113 (50.44%), Query Frame = 0
BLAST of HG10005291 vs. ExPASy Swiss-Prot
Match: B3H6D0 (Heavy metal-associated isoprenylated plant protein 45 OS=Arabidopsis thaliana OX=3702 GN=HIPP45 PE=3 SV=1) HSP 1 Score: 47.0 bits (110), Expect = 1.6e-04 Identity = 37/120 (30.83%), Postives = 57/120 (47.50%), Query Frame = 0
BLAST of HG10005291 vs. ExPASy TrEMBL
Match: A0A0A0K729 (HMA domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_7G048100 PE=4 SV=1) HSP 1 Score: 223.4 bits (568), Expect = 4.7e-55 Identity = 103/111 (92.79%), Postives = 108/111 (97.30%), Query Frame = 0
BLAST of HG10005291 vs. ExPASy TrEMBL
Match: A0A5A7SR16 (Heavy metal-associated isoprenylated plant protein 20 OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold13G003320 PE=4 SV=1) HSP 1 Score: 223.0 bits (567), Expect = 6.1e-55 Identity = 103/111 (92.79%), Postives = 109/111 (98.20%), Query Frame = 0
BLAST of HG10005291 vs. ExPASy TrEMBL
Match: A0A1S3C1U7 (heavy metal-associated isoprenylated plant protein 20 OS=Cucumis melo OX=3656 GN=LOC103495502 PE=4 SV=1) HSP 1 Score: 223.0 bits (567), Expect = 6.1e-55 Identity = 103/111 (92.79%), Postives = 109/111 (98.20%), Query Frame = 0
BLAST of HG10005291 vs. ExPASy TrEMBL
Match: A0A6J1D3X5 (heavy metal-associated isoprenylated plant protein 28 OS=Momordica charantia OX=3673 GN=LOC111016803 PE=4 SV=1) HSP 1 Score: 216.5 bits (550), Expect = 5.7e-53 Identity = 99/111 (89.19%), Postives = 107/111 (96.40%), Query Frame = 0
BLAST of HG10005291 vs. ExPASy TrEMBL
Match: A0A6J1GLW0 (heavy metal-associated isoprenylated plant protein 28 OS=Cucurbita moschata OX=3662 GN=LOC111455170 PE=4 SV=1) HSP 1 Score: 207.2 bits (526), Expect = 3.5e-50 Identity = 94/111 (84.68%), Postives = 104/111 (93.69%), Query Frame = 0
BLAST of HG10005291 vs. TAIR 10
Match: AT1G06330.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 127.1 bits (318), Expect = 8.8e-30 Identity = 68/116 (58.62%), Postives = 81/116 (69.83%), Query Frame = 0
BLAST of HG10005291 vs. TAIR 10
Match: AT1G29100.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 70.5 bits (171), Expect = 9.8e-13 Identity = 43/109 (39.45%), Postives = 62/109 (56.88%), Query Frame = 0
BLAST of HG10005291 vs. TAIR 10
Match: AT2G18196.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 63.9 bits (154), Expect = 9.2e-11 Identity = 36/111 (32.43%), Postives = 63/111 (56.76%), Query Frame = 0
BLAST of HG10005291 vs. TAIR 10
Match: AT4G10465.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 50.8 bits (120), Expect = 8.0e-07 Identity = 35/113 (30.97%), Postives = 57/113 (50.44%), Query Frame = 0
BLAST of HG10005291 vs. TAIR 10
Match: AT3G56891.1 (Heavy metal transport/detoxification superfamily protein ) HSP 1 Score: 47.0 bits (110), Expect = 1.2e-05 Identity = 37/120 (30.83%), Postives = 57/120 (47.50%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|