
HG10004203 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCGAGGTGGTGCTGAATGATCGGTTGGGGAAGAAGGTGAGAGTGAAGTGCAACGACGACGACACCATCGGCGACTTGAAGAAGCTCGTGGCTGCCCAGACTGGGACTAGAGCTGAGAAGATTCGGATTCAGAAATGGTACAATATCTACAAGGATCATATTACTCTCAAGGATTACGAAATCCACGACGGCATGGGCCTCGAACTCTACTACAATTAG ATGATCGAGGTGGTGCTGAATGATCGGTTGGGGAAGAAGGTGAGAGTGAAGTGCAACGACGACGACACCATCGGCGACTTGAAGAAGCTCGTGGCTGCCCAGACTGGGACTAGAGCTGAGAAGATTCGGATTCAGAAATGGTACAATATCTACAAGGATCATATTACTCTCAAGGATTACGAAATCCACGACGGCATGGGCCTCGAACTCTACTACAATTAG ATGATCGAGGTGGTGCTGAATGATCGGTTGGGGAAGAAGGTGAGAGTGAAGTGCAACGACGACGACACCATCGGCGACTTGAAGAAGCTCGTGGCTGCCCAGACTGGGACTAGAGCTGAGAAGATTCGGATTCAGAAATGGTACAATATCTACAAGGATCATATTACTCTCAAGGATTACGAAATCCACGACGGCATGGGCCTCGAACTCTACTACAATTAG MIEVVLNDRLGKKVRVKCNDDDTIGDLKKLVAAQTGTRAEKIRIQKWYNIYKDHITLKDYEIHDGMGLELYYN Homology
BLAST of HG10004203 vs. NCBI nr
Match: NP_199045.1 (ubiquitin-like protein 5 [Arabidopsis thaliana] >XP_042491163.1 ubiquitin-like protein 5 [Macadamia integrifolia] >XP_042518368.1 ubiquitin-like protein 5 [Macadamia integrifolia] >XP_042518369.1 ubiquitin-like protein 5 [Macadamia integrifolia] >XP_042518370.1 ubiquitin-like protein 5 [Macadamia integrifolia] >Q9FGZ9.1 RecName: Full=Ubiquitin-like protein 5 [Arabidopsis thaliana] >KAG7604621.1 Ubiquitin domain [Arabidopsis thaliana x Arabidopsis arenosa] >KAG7611553.1 Ubiquitin domain [Arabidopsis suecica] >OVA18069.1 Ubiquitin domain [Macleaya cordata] >AAK48954.1 ubiquitin-like protein [Arabidopsis thaliana] >AAL66949.1 ubiquitin-like protein [Arabidopsis thaliana]) HSP 1 Score: 153.3 bits (386), Expect = 8.1e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. NCBI nr
Match: XP_002312015.1 (ubiquitin-like protein 5 [Populus trichocarpa] >XP_034919348.1 ubiquitin-like protein 5 [Populus alba] >XP_034919349.1 ubiquitin-like protein 5 [Populus alba] >ABK94311.1 unknown [Populus trichocarpa] >PNT22577.1 hypothetical protein POPTR_008G039100 [Populus trichocarpa] >PNT22578.1 hypothetical protein POPTR_008G039100 [Populus trichocarpa]) HSP 1 Score: 152.5 bits (384), Expect = 1.4e-33 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. NCBI nr
Match: KAC9631537.1 (hypothetical protein E3N88_45505 [Mikania micrantha] >KAC9631539.1 hypothetical protein E3N88_45507 [Mikania micrantha] >KAD7480016.1 hypothetical protein E3N88_03152 [Mikania micrantha]) HSP 1 Score: 152.1 bits (383), Expect = 1.8e-33 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. NCBI nr
Match: XP_022016121.2 (uncharacterized protein LOC110915698 [Helianthus annuus]) HSP 1 Score: 152.1 bits (383), Expect = 1.8e-33 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. NCBI nr
Match: XP_017249268.1 (PREDICTED: ubiquitin-like protein 5 [Daucus carota subsp. sativus] >XP_017249269.1 PREDICTED: ubiquitin-like protein 5 [Daucus carota subsp. sativus] >XP_017249270.1 PREDICTED: ubiquitin-like protein 5 [Daucus carota subsp. sativus] >KZM95859.1 hypothetical protein DCAR_019101 [Daucus carota subsp. sativus]) HSP 1 Score: 152.1 bits (383), Expect = 1.8e-33 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. ExPASy Swiss-Prot
Match: Q9FGZ9 (Ubiquitin-like protein 5 OS=Arabidopsis thaliana OX=3702 GN=UBL5 PE=3 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 1.1e-36 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. ExPASy Swiss-Prot
Match: Q3T0Z3 (Ubiquitin-like protein 5 OS=Bos taurus OX=9913 GN=UBL5 PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 4.0e-28 Identity = 58/72 (80.56%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of HG10004203 vs. ExPASy Swiss-Prot
Match: Q9BZL1 (Ubiquitin-like protein 5 OS=Homo sapiens OX=9606 GN=UBL5 PE=1 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 4.0e-28 Identity = 58/72 (80.56%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of HG10004203 vs. ExPASy Swiss-Prot
Match: Q6EGX7 (Ubiquitin-like protein 5 OS=Mesocricetus auratus OX=10036 GN=UBL5 PE=3 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 4.0e-28 Identity = 58/72 (80.56%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of HG10004203 vs. ExPASy Swiss-Prot
Match: Q9EPV8 (Ubiquitin-like protein 5 OS=Mus musculus OX=10090 GN=Ubl5 PE=1 SV=1) HSP 1 Score: 124.8 bits (312), Expect = 4.0e-28 Identity = 58/72 (80.56%), Postives = 64/72 (88.89%), Query Frame = 0
BLAST of HG10004203 vs. ExPASy TrEMBL
Match: A0A384KQX3 ((thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=AXX17_At5g40140 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 3.9e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. ExPASy TrEMBL
Match: Q570V8 (Ubiquitin-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g42300 PE=2 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 3.9e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. ExPASy TrEMBL
Match: A0A200R5R7 (Ubiquitin domain OS=Macleaya cordata OX=56857 GN=BVC80_1835g482 PE=4 SV=1) HSP 1 Score: 153.3 bits (386), Expect = 3.9e-34 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. ExPASy TrEMBL
Match: A9PD58 (Ubiquitin-like domain-containing protein OS=Populus trichocarpa OX=3694 GN=POPTR_008G039100 PE=2 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 6.7e-34 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. ExPASy TrEMBL
Match: A0A6N2M145 (Ubiquitin-like domain-containing protein OS=Salix viminalis OX=40686 GN=SVIM_LOCUS264022 PE=4 SV=1) HSP 1 Score: 152.5 bits (384), Expect = 6.7e-34 Identity = 72/73 (98.63%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. TAIR 10
Match: AT5G42300.1 (ubiquitin-like protein 5 ) HSP 1 Score: 153.3 bits (386), Expect = 7.5e-38 Identity = 73/73 (100.00%), Postives = 73/73 (100.00%), Query Frame = 0
BLAST of HG10004203 vs. TAIR 10
Match: AT3G45180.1 (Ubiquitin-like superfamily protein ) HSP 1 Score: 146.0 bits (367), Expect = 1.2e-35 Identity = 69/73 (94.52%), Postives = 71/73 (97.26%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01 Position : 0 Zoom : x 1
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|