HG10002717 (gene) Bottle gourd (Hangzhou Gourd) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGAAGAATTTTCCTATCACAGTTGTTTGCATTTTTGTGGTGGCGACCACGGTGGCGCTTTTCAACTGCGCTCGTCCGGTGGCTGCTCAGACAACATGCAACCCTTCGCAGCTAGGTATACCATGTGGAGCAGCATTTTTCTCATCGTCGACGCCCAGTCGCGATTGTTGCAATAAGTTGAGGGAGCAACAACCATGCTACTGTACTTATCTCCACGATCCAAATTTGAAGAATTTGGTGGATTCTCCTGCCGCTAAAAGGATTGCTAAAGCCTGCAATATTACCTTCCCAAGTCAGGCTGAGTGCCCTAACTAG ATGAAGAATTTTCCTATCACAGTTGTTTGCATTTTTGTGGTGGCGACCACGGTGGCGCTTTTCAACTGCGCTCGTCCGGTGGCTGCTCAGACAACATGCAACCCTTCGCAGCTAGGTATACCATGTGGAGCAGCATTTTTCTCATCGTCGACGCCCAGTCGCGATTGTTGCAATAAGTTGAGGGAGCAACAACCATGCTACTGTACTTATCTCCACGATCCAAATTTGAAGAATTTGGTGGATTCTCCTGCCGCTAAAAGGATTGCTAAAGCCTGCAATATTACCTTCCCAAGTCAGGCTGAGTGCCCTAACTAG ATGAAGAATTTTCCTATCACAGTTGTTTGCATTTTTGTGGTGGCGACCACGGTGGCGCTTTTCAACTGCGCTCGTCCGGTGGCTGCTCAGACAACATGCAACCCTTCGCAGCTAGGTATACCATGTGGAGCAGCATTTTTCTCATCGTCGACGCCCAGTCGCGATTGTTGCAATAAGTTGAGGGAGCAACAACCATGCTACTGTACTTATCTCCACGATCCAAATTTGAAGAATTTGGTGGATTCTCCTGCCGCTAAAAGGATTGCTAAAGCCTGCAATATTACCTTCCCAAGTCAGGCTGAGTGCCCTAACTAG MKNFPITVVCIFVVATTVALFNCARPVAAQTTCNPSQLGIPCGAAFFSSSTPSRDCCNKLREQQPCYCTYLHDPNLKNLVDSPAAKRIAKACNITFPSQAECPN Homology
BLAST of HG10002717 vs. NCBI nr
Match: XP_008444079.1 (PREDICTED: non-specific lipid-transfer protein 2P-like [Cucumis melo] >KAA0064163.1 non-specific lipid-transfer protein 2P-like [Cucumis melo var. makuwa] >TYK02866.1 non-specific lipid-transfer protein 2P-like [Cucumis melo var. makuwa]) HSP 1 Score: 137.9 bits (346), Expect = 5.0e-29 Identity = 68/105 (64.76%), Postives = 80/105 (76.19%), Query Frame = 0
BLAST of HG10002717 vs. NCBI nr
Match: KAE8648021.1 (hypothetical protein Csa_005848 [Cucumis sativus]) HSP 1 Score: 135.2 bits (339), Expect = 3.3e-28 Identity = 69/103 (66.99%), Postives = 83/103 (80.58%), Query Frame = 0
BLAST of HG10002717 vs. NCBI nr
Match: KAE8649342.1 (hypothetical protein Csa_014385 [Cucumis sativus]) HSP 1 Score: 131.0 bits (328), Expect = 6.1e-27 Identity = 67/101 (66.34%), Postives = 81/101 (80.20%), Query Frame = 0
BLAST of HG10002717 vs. NCBI nr
Match: KAG6581747.1 (hypothetical protein SDJN03_21749, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 129.0 bits (323), Expect = 2.3e-26 Identity = 66/103 (64.08%), Postives = 73/103 (70.87%), Query Frame = 0
BLAST of HG10002717 vs. NCBI nr
Match: KAG7026200.1 (hypothetical protein SDJN02_12699, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 127.9 bits (320), Expect = 5.2e-26 Identity = 65/103 (63.11%), Postives = 73/103 (70.87%), Query Frame = 0
BLAST of HG10002717 vs. ExPASy Swiss-Prot
Match: Q43681 (Probable non-specific lipid-transfer protein AKCS9 OS=Vigna unguiculata OX=3917 PE=2 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.7e-14 Identity = 42/94 (44.68%), Postives = 58/94 (61.70%), Query Frame = 0
BLAST of HG10002717 vs. ExPASy Swiss-Prot
Match: P86809 (Non-specific lipid-transfer protein 2 OS=Apium graveolens var. rapaceum OX=278110 PE=1 SV=1) HSP 1 Score: 76.3 bits (186), Expect = 2.4e-13 Identity = 34/63 (53.97%), Postives = 44/63 (69.84%), Query Frame = 0
BLAST of HG10002717 vs. ExPASy Swiss-Prot
Match: P82353 (Non-specific lipid-transfer protein 2 OS=Prunus armeniaca OX=36596 PE=1 SV=1) HSP 1 Score: 65.1 bits (157), Expect = 5.4e-10 Identity = 29/66 (43.94%), Postives = 40/66 (60.61%), Query Frame = 0
BLAST of HG10002717 vs. ExPASy Swiss-Prot
Match: P82901 (Non-specific lipid-transfer protein 2P OS=Triticum aestivum OX=4565 PE=1 SV=1) HSP 1 Score: 62.0 bits (149), Expect = 4.6e-09 Identity = 26/65 (40.00%), Postives = 36/65 (55.38%), Query Frame = 0
BLAST of HG10002717 vs. ExPASy Swiss-Prot
Match: P20145 (Probable non-specific lipid-transfer protein OS=Hordeum vulgare OX=4513 GN=LTP2 PE=2 SV=1) HSP 1 Score: 60.5 bits (145), Expect = 1.3e-08 Identity = 30/87 (34.48%), Postives = 40/87 (45.98%), Query Frame = 0
BLAST of HG10002717 vs. ExPASy TrEMBL
Match: A0A5A7V7R4 (Non-specific lipid-transfer protein 2P-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold218G00730 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 2.4e-29 Identity = 68/105 (64.76%), Postives = 80/105 (76.19%), Query Frame = 0
BLAST of HG10002717 vs. ExPASy TrEMBL
Match: A0A1S3BAC3 (non-specific lipid-transfer protein 2P-like OS=Cucumis melo OX=3656 GN=LOC103487519 PE=4 SV=1) HSP 1 Score: 137.9 bits (346), Expect = 2.4e-29 Identity = 68/105 (64.76%), Postives = 80/105 (76.19%), Query Frame = 0
BLAST of HG10002717 vs. ExPASy TrEMBL
Match: A0A0A0KZL4 (Putative lipid transfer protein family protein OS=Cucumis sativus OX=3659 GN=Csa_4G146240 PE=4 SV=1) HSP 1 Score: 135.2 bits (339), Expect = 1.6e-28 Identity = 69/103 (66.99%), Postives = 83/103 (80.58%), Query Frame = 0
BLAST of HG10002717 vs. ExPASy TrEMBL
Match: A0A6J1GTR0 (non-specific lipid-transfer protein 2-like OS=Cucurbita moschata OX=3662 GN=LOC111457455 PE=4 SV=1) HSP 1 Score: 92.4 bits (228), Expect = 1.2e-15 Identity = 49/98 (50.00%), Postives = 63/98 (64.29%), Query Frame = 0
BLAST of HG10002717 vs. ExPASy TrEMBL
Match: A0A7J8TH09 (AAI domain-containing protein OS=Gossypium davidsonii OX=34287 GN=Godav_024776 PE=4 SV=1) HSP 1 Score: 90.5 bits (223), Expect = 4.4e-15 Identity = 44/92 (47.83%), Postives = 60/92 (65.22%), Query Frame = 0
BLAST of HG10002717 vs. TAIR 10
Match: AT1G48750.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 82.8 bits (203), Expect = 1.8e-16 Identity = 42/93 (45.16%), Postives = 56/93 (60.22%), Query Frame = 0
BLAST of HG10002717 vs. TAIR 10
Match: AT3G18280.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 77.8 bits (190), Expect = 5.7e-15 Identity = 37/91 (40.66%), Postives = 56/91 (61.54%), Query Frame = 0
BLAST of HG10002717 vs. TAIR 10
Match: AT1G73780.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 70.1 bits (170), Expect = 1.2e-12 Identity = 39/93 (41.94%), Postives = 52/93 (55.91%), Query Frame = 0
BLAST of HG10002717 vs. TAIR 10
Match: AT5G38170.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 65.9 bits (159), Expect = 2.3e-11 Identity = 28/70 (40.00%), Postives = 38/70 (54.29%), Query Frame = 0
BLAST of HG10002717 vs. TAIR 10
Match: AT5G38195.1 (Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein ) HSP 1 Score: 65.5 bits (158), Expect = 2.9e-11 Identity = 35/98 (35.71%), Postives = 59/98 (60.20%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Bottle gourd (Hangzhou Gourd) v1
Date Performed: 2022-08-01
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|