Cucsat.G1372 (gene) Cucumber (B10) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ACTTTCTTCCAAAATCTTGATCTTGTCAAATAATATATATTCAATTTGGATTTTTAGTATGATTTCTGGTCGTTGTGCAGCTTGTAAGTATTTAAGAAGAAGATGCCCTTCCGATTGTATTTTTTCCCCTTTCTTTCCTTCCAATAATCCTCAAAGATTCACCATTGTTCATCGAATTTATGGTGCTAGTAATGTTGCTAAATTCCTCCATGTAAGTTTATAATATACTTCATTTTCCACCTACCATTTTTAATTCTATATCATATCTCTTATTTCCATTCTTCCCCATGCTTTTTACTTACCATTTAATTCATAAACCCATCTCTTAGTTATCTATCTATTTCTTAGTATAGTATATATTGAGAGAATTAACACTCTTTTTTTCTTTTTCTTTTTTGCTAATTTAATCAGCAACTTCCTACACATTTAAGAGCAGAAGCAGCAGAAACTTTAATTTTTGAGGCAAAATGCAGAATTGAAGATCCAGTTTATGGATGTGTAGGGATTATTTCCCAATTACAACATGAATTACACGTGGCAGAAACCCAGTTGGCCAAAACTCG CTTTCTTCCAAAATCTTGATCTTGTCAAATAATATATATTCAATTTGGATTTTTAGTATGATTTCTGGTCGTTGTGCAGCTTGTAAGTATTTAAGAAGAAGATGCCCTTCCGATTGTATTTTTTCCCCTTTCTTTCCTTCCAATAATCCTCAAAGATTCACCATTGTTCATCGAATTTATGGTGCTAGTAATGTTGCTAAATTCCTCCATCAACTTCCTACACATTTAAGAGCAGAAGCAGCAGAAACTTTAATTTTTGAGGCAAAATGCAGAATTGAAGATCCAGTTTATGGATGTGTAGGGATTATTTCCCAATTACAACATGAATTACACGTGGCAGAAACCCAGTTGGCCAAAACT LSSKILILSNNIYSIWIFSMISGRCAACKYLRRRCPSDCIFSPFFPSNNPQRFTIVHRIYGASNVAKFLHQLPTHLRAEAAETLIFEAKCRIEDPVYGCVGIISQLQHELHVAETQLAKT Homology
BLAST of Cucsat.G1372 vs. ExPASy Swiss-Prot
Match: P59467 (LOB domain-containing protein 23 OS=Arabidopsis thaliana OX=3702 GN=LBD23 PE=1 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.9e-35 Identity = 65/97 (67.01%), Postives = 78/97 (80.41%), Query Frame = 0
BLAST of Cucsat.G1372 vs. ExPASy Swiss-Prot
Match: P59468 (LOB domain-containing protein 24 OS=Arabidopsis thaliana OX=3702 GN=LBD24 PE=2 SV=1) HSP 1 Score: 149.8 bits (377), Expect = 1.9e-35 Identity = 65/97 (67.01%), Postives = 78/97 (80.41%), Query Frame = 0
BLAST of Cucsat.G1372 vs. ExPASy Swiss-Prot
Match: Q8LBW3 (LOB domain-containing protein 12 OS=Arabidopsis thaliana OX=3702 GN=LBD12 PE=1 SV=2) HSP 1 Score: 130.2 bits (326), Expect = 1.6e-29 Identity = 55/97 (56.70%), Postives = 74/97 (76.29%), Query Frame = 0
BLAST of Cucsat.G1372 vs. ExPASy Swiss-Prot
Match: Q9SHE9 (LOB domain-containing protein 4 OS=Arabidopsis thaliana OX=3702 GN=LBD4 PE=1 SV=1) HSP 1 Score: 129.8 bits (325), Expect = 2.1e-29 Identity = 54/94 (57.45%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of Cucsat.G1372 vs. ExPASy Swiss-Prot
Match: Q32SG3 (LOB domain-containing protein 6 OS=Zea mays OX=4577 GN=LBD6 PE=1 SV=1) HSP 1 Score: 122.5 bits (306), Expect = 3.3e-27 Identity = 52/95 (54.74%), Postives = 70/95 (73.68%), Query Frame = 0
BLAST of Cucsat.G1372 vs. NCBI nr
Match: XP_004140854.1 (LOB domain-containing protein 24 [Cucumis sativus] >KGN57342.1 hypothetical protein Csa_009713 [Cucumis sativus]) HSP 1 Score: 213 bits (541), Expect = 1.76e-68 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Cucsat.G1372 vs. NCBI nr
Match: XP_008439169.1 (PREDICTED: LOB domain-containing protein 24-like [Cucumis melo]) HSP 1 Score: 210 bits (534), Expect = 1.92e-67 Identity = 99/101 (98.02%), Postives = 100/101 (99.01%), Query Frame = 0
BLAST of Cucsat.G1372 vs. NCBI nr
Match: XP_022985104.1 (LOB domain-containing protein 24-like [Cucurbita maxima]) HSP 1 Score: 206 bits (524), Expect = 5.63e-66 Identity = 97/101 (96.04%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of Cucsat.G1372 vs. NCBI nr
Match: XP_023522202.1 (LOB domain-containing protein 24-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 204 bits (518), Expect = 4.47e-65 Identity = 96/101 (95.05%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of Cucsat.G1372 vs. NCBI nr
Match: KAG7014789.1 (LOB domain-containing protein 24, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 202 bits (515), Expect = 1.28e-64 Identity = 95/101 (94.06%), Postives = 97/101 (96.04%), Query Frame = 0
BLAST of Cucsat.G1372 vs. ExPASy TrEMBL
Match: A0A0A0L9N7 (LOB domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_3G180300 PE=3 SV=1) HSP 1 Score: 213 bits (541), Expect = 8.52e-69 Identity = 101/101 (100.00%), Postives = 101/101 (100.00%), Query Frame = 0
BLAST of Cucsat.G1372 vs. ExPASy TrEMBL
Match: A0A1S3AY36 (LOB domain-containing protein 24-like OS=Cucumis melo OX=3656 GN=LOC103484045 PE=3 SV=1) HSP 1 Score: 210 bits (534), Expect = 9.30e-68 Identity = 99/101 (98.02%), Postives = 100/101 (99.01%), Query Frame = 0
BLAST of Cucsat.G1372 vs. ExPASy TrEMBL
Match: A0A6J1JCD0 (LOB domain-containing protein 24-like OS=Cucurbita maxima OX=3661 GN=LOC111483182 PE=3 SV=1) HSP 1 Score: 206 bits (524), Expect = 2.72e-66 Identity = 97/101 (96.04%), Postives = 98/101 (97.03%), Query Frame = 0
BLAST of Cucsat.G1372 vs. ExPASy TrEMBL
Match: A0A6J1E5I6 (LOB domain-containing protein 24-like OS=Cucurbita moschata OX=3662 GN=LOC111430896 PE=3 SV=1) HSP 1 Score: 199 bits (506), Expect = 1.46e-63 Identity = 94/101 (93.07%), Postives = 96/101 (95.05%), Query Frame = 0
BLAST of Cucsat.G1372 vs. ExPASy TrEMBL
Match: A0A0A0LLX6 (LOB domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_2G373510 PE=3 SV=1) HSP 1 Score: 184 bits (467), Expect = 1.27e-57 Identity = 87/101 (86.14%), Postives = 92/101 (91.09%), Query Frame = 0
BLAST of Cucsat.G1372 vs. TAIR 10
Match: AT3G26620.1 (LOB domain-containing protein 23 ) HSP 1 Score: 149.8 bits (377), Expect = 1.4e-36 Identity = 65/97 (67.01%), Postives = 78/97 (80.41%), Query Frame = 0
BLAST of Cucsat.G1372 vs. TAIR 10
Match: AT3G26660.1 (LOB domain-containing protein 24 ) HSP 1 Score: 149.8 bits (377), Expect = 1.4e-36 Identity = 65/97 (67.01%), Postives = 78/97 (80.41%), Query Frame = 0
BLAST of Cucsat.G1372 vs. TAIR 10
Match: AT2G30130.1 (Lateral organ boundaries (LOB) domain family protein ) HSP 1 Score: 130.2 bits (326), Expect = 1.1e-30 Identity = 55/97 (56.70%), Postives = 74/97 (76.29%), Query Frame = 0
BLAST of Cucsat.G1372 vs. TAIR 10
Match: AT1G31320.1 (LOB domain-containing protein 4 ) HSP 1 Score: 129.8 bits (325), Expect = 1.5e-30 Identity = 54/94 (57.45%), Postives = 71/94 (75.53%), Query Frame = 0
BLAST of Cucsat.G1372 vs. TAIR 10
Match: AT3G27650.1 (LOB domain-containing protein 25 ) HSP 1 Score: 122.1 bits (305), Expect = 3.1e-28 Identity = 52/114 (45.61%), Postives = 82/114 (71.93%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (B10) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|