![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Csor.00g297560 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSsinglestart_codonpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGTTTCTCTCACTCTGGCCCTATGGCCGTATACTGGGGCGGCGTCCCACAGGCCAAAAAACTCTGCCTCGCGTGTGGGGGGCGTGCCGCTCGTCCCATGGCTGCCTTCACTGTCGATCGCCATCAATCTTTTCCTTCTTGGCTCCATCGACAAAGCTTCATTTGAAAGGTTTGGAATATGGACTGGGATTCTATTGGTTTACTATATCTTGATTGGATTACATGCTTCTTATGACTCGGCAATAGAGTCCAAGACTATAGCAGGAGAAGTTAATAGCAGTTTGTGA ATGGTTTCTCTCACTCTGGCCCTATGGCCGTATACTGGGGCGGCGTCCCACAGGCCAAAAAACTCTGCCTCGCGTGTGGGGGGCGTGCCGCTCGTCCCATGGCTGCCTTCACTGTCGATCGCCATCAATCTTTTCCTTCTTGGCTCCATCGACAAAGCTTCATTTGAAAGGTTTGGAATATGGACTGGGATTCTATTGGTTTACTATATCTTGATTGGATTACATGCTTCTTATGACTCGGCAATAGAGTCCAAGACTATAGCAGGAGAAGTTAATAGCAGTTTGTGA ATGGTTTCTCTCACTCTGGCCCTATGGCCGTATACTGGGGCGGCGTCCCACAGGCCAAAAAACTCTGCCTCGCGTGTGGGGGGCGTGCCGCTCGTCCCATGGCTGCCTTCACTGTCGATCGCCATCAATCTTTTCCTTCTTGGCTCCATCGACAAAGCTTCATTTGAAAGGTTTGGAATATGGACTGGGATTCTATTGGTTTACTATATCTTGATTGGATTACATGCTTCTTATGACTCGGCAATAGAGTCCAAGACTATAGCAGGAGAAGTTAATAGCAGTTTGTGA MVSLTLALWPYTGAASHRPKNSASRVGGVPLVPWLPSLSIAINLFLLGSIDKASFERFGIWTGILLVYYILIGLHASYDSAIESKTIAGEVNSSL Homology
BLAST of Csor.00g297560 vs. ExPASy Swiss-Prot
Match: Q84MA5 (Cationic amino acid transporter 1 OS=Arabidopsis thaliana OX=3702 GN=CAT1 PE=1 SV=1) HSP 1 Score: 99.4 bits (246), Expect = 2.4e-20 Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of Csor.00g297560 vs. ExPASy Swiss-Prot
Match: Q9SHH0 (Cationic amino acid transporter 8, vacuolar OS=Arabidopsis thaliana OX=3702 GN=CAT8 PE=2 SV=1) HSP 1 Score: 80.5 bits (197), Expect = 1.1e-14 Identity = 40/75 (53.33%), Postives = 52/75 (69.33%), Query Frame = 0
BLAST of Csor.00g297560 vs. ExPASy Swiss-Prot
Match: O64759 (Cationic amino acid transporter 5 OS=Arabidopsis thaliana OX=3702 GN=CAT5 PE=1 SV=1) HSP 1 Score: 78.6 bits (192), Expect = 4.3e-14 Identity = 35/63 (55.56%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of Csor.00g297560 vs. ExPASy Swiss-Prot
Match: Q9SQZ0 (Cationic amino acid transporter 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CAT7 PE=3 SV=1) HSP 1 Score: 67.8 bits (164), Expect = 7.6e-11 Identity = 27/53 (50.94%), Postives = 42/53 (79.25%), Query Frame = 0
BLAST of Csor.00g297560 vs. ExPASy Swiss-Prot
Match: Q9LZ20 (Cationic amino acid transporter 6, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CAT6 PE=2 SV=1) HSP 1 Score: 66.6 bits (161), Expect = 1.7e-10 Identity = 27/62 (43.55%), Postives = 44/62 (70.97%), Query Frame = 0
BLAST of Csor.00g297560 vs. NCBI nr
Match: KAG6573396.1 (Cationic amino acid transporter 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 191 bits (486), Expect = 2.27e-61 Identity = 95/95 (100.00%), Postives = 95/95 (100.00%), Query Frame = 0
BLAST of Csor.00g297560 vs. NCBI nr
Match: XP_022994107.1 (cationic amino acid transporter 1-like, partial [Cucurbita maxima]) HSP 1 Score: 136 bits (343), Expect = 1.22e-37 Identity = 71/91 (78.02%), Postives = 76/91 (83.52%), Query Frame = 0
BLAST of Csor.00g297560 vs. NCBI nr
Match: KAG6573394.1 (Cationic amino acid transporter 1, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 141 bits (356), Expect = 4.63e-37 Identity = 75/91 (82.42%), Postives = 77/91 (84.62%), Query Frame = 0
BLAST of Csor.00g297560 vs. NCBI nr
Match: XP_023524525.1 (cationic amino acid transporter 1-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 135 bits (341), Expect = 1.52e-36 Identity = 71/91 (78.02%), Postives = 75/91 (82.42%), Query Frame = 0
BLAST of Csor.00g297560 vs. NCBI nr
Match: XP_022955316.1 (cationic amino acid transporter 1-like isoform X2 [Cucurbita moschata]) HSP 1 Score: 139 bits (349), Expect = 4.52e-36 Identity = 74/91 (81.32%), Postives = 76/91 (83.52%), Query Frame = 0
BLAST of Csor.00g297560 vs. ExPASy TrEMBL
Match: A0A6J1JUS8 (cationic amino acid transporter 1-like OS=Cucurbita maxima OX=3661 GN=LOC111489935 PE=4 SV=1) HSP 1 Score: 136 bits (343), Expect = 5.92e-38 Identity = 71/91 (78.02%), Postives = 76/91 (83.52%), Query Frame = 0
BLAST of Csor.00g297560 vs. ExPASy TrEMBL
Match: A0A6J1GT83 (cationic amino acid transporter 1-like isoform X3 OS=Cucurbita moschata OX=3662 GN=LOC111457315 PE=4 SV=1) HSP 1 Score: 139 bits (349), Expect = 2.19e-36 Identity = 74/91 (81.32%), Postives = 76/91 (83.52%), Query Frame = 0
BLAST of Csor.00g297560 vs. ExPASy TrEMBL
Match: A0A6J1GTG0 (cationic amino acid transporter 1-like isoform X2 OS=Cucurbita moschata OX=3662 GN=LOC111457315 PE=4 SV=1) HSP 1 Score: 139 bits (349), Expect = 2.19e-36 Identity = 74/91 (81.32%), Postives = 76/91 (83.52%), Query Frame = 0
BLAST of Csor.00g297560 vs. ExPASy TrEMBL
Match: A0A6J1K493 (cationic amino acid transporter 1-like OS=Cucurbita maxima OX=3661 GN=LOC111490511 PE=4 SV=1) HSP 1 Score: 137 bits (346), Expect = 3.16e-36 Identity = 72/91 (79.12%), Postives = 76/91 (83.52%), Query Frame = 0
BLAST of Csor.00g297560 vs. ExPASy TrEMBL
Match: A0A6J1IIW9 (cationic amino acid transporter 1-like OS=Cucurbita maxima OX=3661 GN=LOC111474509 PE=4 SV=1) HSP 1 Score: 135 bits (340), Expect = 8.76e-36 Identity = 72/91 (79.12%), Postives = 75/91 (82.42%), Query Frame = 0
BLAST of Csor.00g297560 vs. TAIR 10
Match: AT4G21120.1 (amino acid transporter 1 ) HSP 1 Score: 99.4 bits (246), Expect = 1.7e-21 Identity = 45/63 (71.43%), Postives = 53/63 (84.13%), Query Frame = 0
BLAST of Csor.00g297560 vs. TAIR 10
Match: AT1G17120.1 (cationic amino acid transporter 8 ) HSP 1 Score: 80.5 bits (197), Expect = 8.1e-16 Identity = 40/75 (53.33%), Postives = 52/75 (69.33%), Query Frame = 0
BLAST of Csor.00g297560 vs. TAIR 10
Match: AT2G34960.1 (cationic amino acid transporter 5 ) HSP 1 Score: 78.6 bits (192), Expect = 3.1e-15 Identity = 35/63 (55.56%), Postives = 47/63 (74.60%), Query Frame = 0
BLAST of Csor.00g297560 vs. TAIR 10
Match: AT3G10600.1 (cationic amino acid transporter 7 ) HSP 1 Score: 67.8 bits (164), Expect = 5.4e-12 Identity = 27/53 (50.94%), Postives = 42/53 (79.25%), Query Frame = 0
BLAST of Csor.00g297560 vs. TAIR 10
Match: AT5G04770.1 (cationic amino acid transporter 6 ) HSP 1 Score: 66.6 bits (161), Expect = 1.2e-11 Identity = 27/62 (43.55%), Postives = 44/62 (70.97%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|