Csor.00g242210 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSinitialstart_codonpolypeptideintronterminalstop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCGGTTTCCAGGATGTCTTTTGGATTTGTGGCTGCCGCTGCGCTCATCTTTGCCATCTTCTTGCCGGTTGCTCAGCCTCAGTCCTTGGCTCCGGCACCCGCTCCCACCAGCGACGGTTAGTTCTCTTCTTAATTTCTATTTCTTTAAGTTTTGTTTTGTATTTTTGTTCTAGATCTGTGTGGACTGTTGATCTCTGGCTTGAAATTAGTTTTGTTTGTTTATTCTTTGTTTCTGGATTATTTTGCGAGTTTCAGTTTCTGAGTTACCAAAACATTGTTTCGGTTTCCGGTTCTTCTTTGTTTCCGGATTATTTTGAGAGTTTCAGTTTCTGAGTTACCAAAACATTGTTTCGGTTTCCGTTTCTTGGTGAATTGTGATTAAAGATATTAAGCGCAAATCTTCACTTTTTTTTCCCCTTTAGTAGTTTTGATTGTTTGTTCAAGCCTTGGTGGATCTATTTTCCTACACGTATGTGTATTCTCAATTTTGCGAGAGTTCATTAGCATCAATTTGTGGACCAAATGTTAGAAATGACAAATAATACAGAAGCTATTTTCTTGTATTCGTAACAACGGCATAAAGTTATCTTATAGTTTCTATAAACTATTAATTTGCGAGTGTAATTAAACCTATTGCCATGATTATGAAAAGTAATTCTGTTTGCTATTTGGTTGGCCTGACTACTATTACGTTACCTTTTAGAACAAAGGTGTTTGGTCTTGATGTCTTATCTTCTCAGAAATTCATTTTAAATAGTTCTTTGAAATGCAAAATCCTAAGGAATTAGGGTTGAAATTCATAGATTTCTTAGTGAACTTAATTGGTATCTTTAAAACGTCATTTACAGGGACATCCATAGACCAAGGGATAGCTTATGTGTTGATGTTGGTGGCATTGGCACTCACATATCTCATCCACAACGCTGACTTATCCAACAGCTTCTAA ATGGCGGTTTCCAGGATGTCTTTTGGATTTGTGGCTGCCGCTGCGCTCATCTTTGCCATCTTCTTGCCGGTTGCTCAGCCTCAGTCCTTGGCTCCGGCACCCGCTCCCACCAGCGACGGGACATCCATAGACCAAGGGATAGCTTATGTGTTGATGTTGGTGGCATTGGCACTCACATATCTCATCCACAACGCTGACTTATCCAACAGCTTCTAA ATGGCGGTTTCCAGGATGTCTTTTGGATTTGTGGCTGCCGCTGCGCTCATCTTTGCCATCTTCTTGCCGGTTGCTCAGCCTCAGTCCTTGGCTCCGGCACCCGCTCCCACCAGCGACGGGACATCCATAGACCAAGGGATAGCTTATGTGTTGATGTTGGTGGCATTGGCACTCACATATCTCATCCACAACGCTGACTTATCCAACAGCTTCTAA MAVSRMSFGFVAAAALIFAIFLPVAQPQSLAPAPAPTSDGTSIDQGIAYVLMLVALALTYLIHNADLSNSF Homology
BLAST of Csor.00g242210 vs. ExPASy Swiss-Prot
Match: Q8L9T8 (Arabinogalactan protein 41 OS=Arabidopsis thaliana OX=3702 GN=AGP41 PE=1 SV=1) HSP 1 Score: 84.0 bits (206), Expect = 7.7e-16 Identity = 45/63 (71.43%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of Csor.00g242210 vs. ExPASy Swiss-Prot
Match: Q9M373 (Arabinogalactan protein 20 OS=Arabidopsis thaliana OX=3702 GN=AGP20 PE=1 SV=1) HSP 1 Score: 82.4 bits (202), Expect = 2.2e-15 Identity = 44/67 (65.67%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of Csor.00g242210 vs. ExPASy Swiss-Prot
Match: O82337 (Arabinogalactan protein 16 OS=Arabidopsis thaliana OX=3702 GN=AGP16 PE=1 SV=1) HSP 1 Score: 80.1 bits (196), Expect = 1.1e-14 Identity = 44/68 (64.71%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of Csor.00g242210 vs. ExPASy Swiss-Prot
Match: Q9FK16 (Arabinogalactan protein 22 OS=Arabidopsis thaliana OX=3702 GN=AGP22 PE=1 SV=1) HSP 1 Score: 73.6 bits (179), Expect = 1.0e-12 Identity = 40/63 (63.49%), Postives = 46/63 (73.02%), Query Frame = 0
BLAST of Csor.00g242210 vs. NCBI nr
Match: KAG6577157.1 (Arabinogalactan protein 20, partial [Cucurbita argyrosperma subsp. sororia] >KAG7015155.1 Arabinogalactan peptide 20, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 132 bits (331), Expect = 1.84e-38 Identity = 71/71 (100.00%), Postives = 71/71 (100.00%), Query Frame = 0
BLAST of Csor.00g242210 vs. NCBI nr
Match: XP_022931316.1 (arabinogalactan peptide 22-like [Cucurbita moschata]) HSP 1 Score: 129 bits (325), Expect = 1.52e-37 Identity = 70/71 (98.59%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of Csor.00g242210 vs. NCBI nr
Match: XP_022985432.1 (arabinogalactan peptide 20 [Cucurbita maxima]) HSP 1 Score: 127 bits (320), Expect = 8.80e-37 Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of Csor.00g242210 vs. NCBI nr
Match: XP_038882280.1 (arabinogalactan protein 22-like [Benincasa hispida]) HSP 1 Score: 122 bits (306), Expect = 1.20e-34 Identity = 65/71 (91.55%), Postives = 68/71 (95.77%), Query Frame = 0
BLAST of Csor.00g242210 vs. NCBI nr
Match: XP_022136454.1 (arabinogalactan peptide 22-like [Momordica charantia]) HSP 1 Score: 122 bits (306), Expect = 1.20e-34 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Csor.00g242210 vs. ExPASy TrEMBL
Match: A0A6J1ETC6 (arabinogalactan peptide 22-like OS=Cucurbita moschata OX=3662 GN=LOC111437536 PE=4 SV=1) HSP 1 Score: 129 bits (325), Expect = 7.35e-38 Identity = 70/71 (98.59%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of Csor.00g242210 vs. ExPASy TrEMBL
Match: A0A6J1J4V7 (arabinogalactan peptide 20 OS=Cucurbita maxima OX=3661 GN=LOC111483439 PE=4 SV=1) HSP 1 Score: 127 bits (320), Expect = 4.26e-37 Identity = 69/71 (97.18%), Postives = 70/71 (98.59%), Query Frame = 0
BLAST of Csor.00g242210 vs. ExPASy TrEMBL
Match: A0A6J1C4C2 (arabinogalactan peptide 22-like OS=Momordica charantia OX=3673 GN=LOC111008162 PE=4 SV=1) HSP 1 Score: 122 bits (306), Expect = 5.83e-35 Identity = 66/71 (92.96%), Postives = 67/71 (94.37%), Query Frame = 0
BLAST of Csor.00g242210 vs. ExPASy TrEMBL
Match: A0A6J1FMT5 (arabinogalactan peptide 22-like OS=Cucurbita moschata OX=3662 GN=LOC111446885 PE=4 SV=1) HSP 1 Score: 116 bits (290), Expect = 1.80e-32 Identity = 62/70 (88.57%), Postives = 66/70 (94.29%), Query Frame = 0
BLAST of Csor.00g242210 vs. ExPASy TrEMBL
Match: A0A5D3CYF3 (Arabinogalactan peptide 22-like OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold21G004150 PE=4 SV=1) HSP 1 Score: 113 bits (282), Expect = 2.68e-31 Identity = 61/70 (87.14%), Postives = 64/70 (91.43%), Query Frame = 0
BLAST of Csor.00g242210 vs. TAIR 10
Match: AT5G24105.1 (arabinogalactan protein 41 ) HSP 1 Score: 84.0 bits (206), Expect = 5.5e-17 Identity = 45/63 (71.43%), Postives = 51/63 (80.95%), Query Frame = 0
BLAST of Csor.00g242210 vs. TAIR 10
Match: AT3G61640.1 (arabinogalactan protein 20 ) HSP 1 Score: 82.4 bits (202), Expect = 1.6e-16 Identity = 44/67 (65.67%), Postives = 51/67 (76.12%), Query Frame = 0
BLAST of Csor.00g242210 vs. TAIR 10
Match: AT2G46330.1 (arabinogalactan protein 16 ) HSP 1 Score: 80.1 bits (196), Expect = 7.9e-16 Identity = 44/68 (64.71%), Postives = 52/68 (76.47%), Query Frame = 0
BLAST of Csor.00g242210 vs. TAIR 10
Match: AT5G53250.1 (arabinogalactan protein 22 ) HSP 1 Score: 73.6 bits (179), Expect = 7.4e-14 Identity = 40/63 (63.49%), Postives = 46/63 (73.02%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|