![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Csor.00g167650 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSstart_codonsinglepolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGGGAATTCCAAAAGCAAAACTTACAAACGAGTTCTTGTTCCATTCTCAGAGGAACAACTAGCTAGCGTTTTCAAGAACCACGACGGAGATGGTGATGGAAAGCTAACAAAGGAGGAGTTGAAGCAAGCCTTCGACTATCTTGGTTCACGCTTCAGCTCGTTCAGAGTAGAAGAGGCCCTACGTGCAGCTGATACCGACGGTGATGGTTTCATCAGCATGGCCGAGATGGGCAAGCTAATTCAATATGCCAAAAGTCGTAAATACACTCTTTGTTAA ATGGGGAATTCCAAAAGCAAAACTTACAAACGAGTTCTTGTTCCATTCTCAGAGGAACAACTAGCTAGCGTTTTCAAGAACCACGACGGAGATGGTGATGGAAAGCTAACAAAGGAGGAGTTGAAGCAAGCCTTCGACTATCTTGGTTCACGCTTCAGCTCGTTCAGAGTAGAAGAGGCCCTACGTGCAGCTGATACCGACGGTGATGGTTTCATCAGCATGGCCGAGATGGGCAAGCTAATTCAATATGCCAAAAGTCGTAAATACACTCTTTGTTAA ATGGGGAATTCCAAAAGCAAAACTTACAAACGAGTTCTTGTTCCATTCTCAGAGGAACAACTAGCTAGCGTTTTCAAGAACCACGACGGAGATGGTGATGGAAAGCTAACAAAGGAGGAGTTGAAGCAAGCCTTCGACTATCTTGGTTCACGCTTCAGCTCGTTCAGAGTAGAAGAGGCCCTACGTGCAGCTGATACCGACGGTGATGGTTTCATCAGCATGGCCGAGATGGGCAAGCTAATTCAATATGCCAAAAGTCGTAAATACACTCTTTGTTAA MGNSKSKTYKRVLVPFSEEQLASVFKNHDGDGDGKLTKEELKQAFDYLGSRFSSFRVEEALRAADTDGDGFISMAEMGKLIQYAKSRKYTLC Homology
BLAST of Csor.00g167650 vs. ExPASy Swiss-Prot
Match: P05933 (Calmodulin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cam1 PE=1 SV=1) HSP 1 Score: 56.2 bits (134), Expect = 2.2e-07 Identity = 28/65 (43.08%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of Csor.00g167650 vs. ExPASy Swiss-Prot
Match: Q9FIH9 (Calcium-binding protein CML37 OS=Arabidopsis thaliana OX=3702 GN=CML37 PE=1 SV=1) HSP 1 Score: 55.8 bits (133), Expect = 2.9e-07 Identity = 27/63 (42.86%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of Csor.00g167650 vs. ExPASy Swiss-Prot
Match: Q9HFY6 (Calmodulin OS=Blastocladiella emersonii OX=4808 GN=CMD1 PE=3 SV=3) HSP 1 Score: 54.3 bits (129), Expect = 8.5e-07 Identity = 27/65 (41.54%), Postives = 38/65 (58.46%), Query Frame = 0
BLAST of Csor.00g167650 vs. ExPASy Swiss-Prot
Match: A0T2M3 (Polcalcin Cup a 4 OS=Hesperocyparis arizonica OX=49011 PE=1 SV=1) HSP 1 Score: 54.3 bits (129), Expect = 8.5e-07 Identity = 27/73 (36.99%), Postives = 41/73 (56.16%), Query Frame = 0
BLAST of Csor.00g167650 vs. ExPASy Swiss-Prot
Match: Q8RZB5 (Probable calcium-binding protein CML10 OS=Oryza sativa subsp. japonica OX=39947 GN=CML10 PE=2 SV=1) HSP 1 Score: 53.9 bits (128), Expect = 1.1e-06 Identity = 25/66 (37.88%), Postives = 38/66 (57.58%), Query Frame = 0
BLAST of Csor.00g167650 vs. NCBI nr
Match: KAG6598376.1 (hypothetical protein SDJN03_08154, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 186 bits (472), Expect = 2.50e-59 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Csor.00g167650 vs. NCBI nr
Match: KAG7029343.1 (Calcium-binding protein CML37, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 181 bits (459), Expect = 2.41e-57 Identity = 90/92 (97.83%), Postives = 90/92 (97.83%), Query Frame = 0
BLAST of Csor.00g167650 vs. NCBI nr
Match: KAA0060899.1 (putative Calcium-binding EF-hand family protein [Cucumis melo var. makuwa]) HSP 1 Score: 163 bits (413), Expect = 2.51e-50 Identity = 80/91 (87.91%), Postives = 87/91 (95.60%), Query Frame = 0
BLAST of Csor.00g167650 vs. NCBI nr
Match: KAG6585662.1 (hypothetical protein SDJN03_18395, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 160 bits (404), Expect = 5.93e-49 Identity = 77/92 (83.70%), Postives = 84/92 (91.30%), Query Frame = 0
BLAST of Csor.00g167650 vs. NCBI nr
Match: KAG7020569.1 (hypothetical protein SDJN02_17255, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 157 bits (396), Expect = 9.85e-48 Identity = 75/92 (81.52%), Postives = 85/92 (92.39%), Query Frame = 0
BLAST of Csor.00g167650 vs. ExPASy TrEMBL
Match: A0A5A7V5B0 (Putative Calcium-binding EF-hand family protein OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold501G00320 PE=4 SV=1) HSP 1 Score: 163 bits (413), Expect = 1.22e-50 Identity = 80/91 (87.91%), Postives = 87/91 (95.60%), Query Frame = 0
BLAST of Csor.00g167650 vs. ExPASy TrEMBL
Match: A0A0A0LRB6 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_2G357340 PE=4 SV=1) HSP 1 Score: 161 bits (407), Expect = 1.00e-49 Identity = 79/91 (86.81%), Postives = 86/91 (94.51%), Query Frame = 0
BLAST of Csor.00g167650 vs. ExPASy TrEMBL
Match: A0A2N9FYQ0 (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS20260 PE=4 SV=1) HSP 1 Score: 102 bits (254), Expect = 2.04e-26 Identity = 44/87 (50.57%), Postives = 65/87 (74.71%), Query Frame = 0
BLAST of Csor.00g167650 vs. ExPASy TrEMBL
Match: A0A5A7VBH2 (Calcium-binding EF-hand OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold134G003470 PE=4 SV=1) HSP 1 Score: 100 bits (248), Expect = 1.98e-25 Identity = 44/83 (53.01%), Postives = 61/83 (73.49%), Query Frame = 0
BLAST of Csor.00g167650 vs. ExPASy TrEMBL
Match: A0A0A0L4V0 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G639740 PE=4 SV=1) HSP 1 Score: 97.1 bits (240), Expect = 3.26e-24 Identity = 42/83 (50.60%), Postives = 61/83 (73.49%), Query Frame = 0
BLAST of Csor.00g167650 vs. TAIR 10
Match: AT5G42380.1 (calmodulin like 37 ) HSP 1 Score: 55.8 bits (133), Expect = 2.1e-08 Identity = 27/63 (42.86%), Postives = 38/63 (60.32%), Query Frame = 0
BLAST of Csor.00g167650 vs. TAIR 10
Match: AT5G12180.1 (calcium-dependent protein kinase 17 ) HSP 1 Score: 52.0 bits (123), Expect = 3.0e-07 Identity = 29/79 (36.71%), Postives = 41/79 (51.90%), Query Frame = 0
BLAST of Csor.00g167650 vs. TAIR 10
Match: AT5G19360.1 (calcium-dependent protein kinase 34 ) HSP 1 Score: 52.0 bits (123), Expect = 3.0e-07 Identity = 29/79 (36.71%), Postives = 41/79 (51.90%), Query Frame = 0
BLAST of Csor.00g167650 vs. TAIR 10
Match: AT4G04695.1 (calcium-dependent protein kinase 31 ) HSP 1 Score: 51.6 bits (122), Expect = 3.9e-07 Identity = 31/79 (39.24%), Postives = 40/79 (50.63%), Query Frame = 0
BLAST of Csor.00g167650 vs. TAIR 10
Match: AT1G76650.1 (calmodulin-like 38 ) HSP 1 Score: 51.2 bits (121), Expect = 5.1e-07 Identity = 24/63 (38.10%), Postives = 39/63 (61.90%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|