Csor.00g147210 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSstart_codonsinglepolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGGCCCCTTCTGGAGGCAAAATGGCCACGAGAACCAGAGCTAATTTACCCAACTTGAAGCTGAACAAGAAAATCAAGAAGACGAAGAAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAAAAGCTGAAGCAGATTCCAGCGGCGATACCAAACGACGCCGTTCATTTCACCGACGACTCTACTGACATCGACTGCGGGTGCAGCACTCCAAAAGCAGAGAGATTCAGAATCCCGGAGATTCTAACGTGTCCGCCGGCCCCCAAGAAGCCAAGACCCGCTTCGGATTGCTCATTACGACGATCGCCCATTGCCTTTTTTGCTCCTCCAGAATTAGAGCTCTTCTTCTGCGCCTTGCCGGTGCCTGACATTTCAGTCTGA ATGGCCCCTTCTGGAGGCAAAATGGCCACGAGAACCAGAGCTAATTTACCCAACTTGAAGCTGAACAAGAAAATCAAGAAGACGAAGAAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAAAAGCTGAAGCAGATTCCAGCGGCGATACCAAACGACGCCGTTCATTTCACCGACGACTCTACTGACATCGACTGCGGGTGCAGCACTCCAAAAGCAGAGAGATTCAGAATCCCGGAGATTCTAACGTGTCCGCCGGCCCCCAAGAAGCCAAGACCCGCTTCGGATTGCTCATTACGACGATCGCCCATTGCCTTTTTTGCTCCTCCAGAATTAGAGCTCTTCTTCTGCGCCTTGCCGGTGCCTGACATTTCAGTCTGA ATGGCCCCTTCTGGAGGCAAAATGGCCACGAGAACCAGAGCTAATTTACCCAACTTGAAGCTGAACAAGAAAATCAAGAAGACGAAGAAACAGCAGCAGCAGCAGCAGCAGCAGCAGCAAAAGCTGAAGCAGATTCCAGCGGCGATACCAAACGACGCCGTTCATTTCACCGACGACTCTACTGACATCGACTGCGGGTGCAGCACTCCAAAAGCAGAGAGATTCAGAATCCCGGAGATTCTAACGTGTCCGCCGGCCCCCAAGAAGCCAAGACCCGCTTCGGATTGCTCATTACGACGATCGCCCATTGCCTTTTTTGCTCCTCCAGAATTAGAGCTCTTCTTCTGCGCCTTGCCGGTGCCTGACATTTCAGTCTGA MAPSGGKMATRTRANLPNLKLNKKIKKTKKQQQQQQQQQQKLKQIPAAIPNDAVHFTDDSTDIDCGCSTPKAERFRIPEILTCPPAPKKPRPASDCSLRRSPIAFFAPPELELFFCALPVPDISV Homology
BLAST of Csor.00g147210 vs. ExPASy Swiss-Prot
Match: Q3ECS5 (Cyclin-dependent protein kinase inhibitor SMR9 OS=Arabidopsis thaliana OX=3702 GN=SMR9 PE=3 SV=1) HSP 1 Score: 72.8 bits (177), Expect = 3.1e-12 Identity = 35/59 (59.32%), Postives = 43/59 (72.88%), Query Frame = 0
BLAST of Csor.00g147210 vs. ExPASy Swiss-Prot
Match: F4IWB3 (Cyclin-dependent protein kinase inhibitor SMR13 OS=Arabidopsis thaliana OX=3702 GN=SMR13 PE=4 SV=1) HSP 1 Score: 69.3 bits (168), Expect = 3.5e-11 Identity = 45/103 (43.69%), Postives = 55/103 (53.40%), Query Frame = 0
BLAST of Csor.00g147210 vs. ExPASy Swiss-Prot
Match: Q1G3Y4 (Cyclin-dependent protein kinase inhibitor SMR15 OS=Arabidopsis thaliana OX=3702 GN=SMR15 PE=3 SV=1) HSP 1 Score: 47.8 bits (112), Expect = 1.1e-04 Identity = 28/70 (40.00%), Postives = 39/70 (55.71%), Query Frame = 0
BLAST of Csor.00g147210 vs. ExPASy Swiss-Prot
Match: Q29Q81 (Cyclin-dependent protein kinase inhibitor SMR6 OS=Arabidopsis thaliana OX=3702 GN=SMR6 PE=1 SV=1) HSP 1 Score: 45.8 bits (107), Expect = 4.1e-04 Identity = 31/72 (43.06%), Postives = 40/72 (55.56%), Query Frame = 0
BLAST of Csor.00g147210 vs. NCBI nr
Match: KAG6570398.1 (Cyclin-dependent protein kinase inhibitor SMR13, partial [Cucurbita argyrosperma subsp. sororia]) HSP 1 Score: 248 bits (632), Expect = 1.10e-82 Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 0
BLAST of Csor.00g147210 vs. NCBI nr
Match: XP_022944116.1 (cyclin-dependent protein kinase inhibitor SMR13 [Cucurbita moschata]) HSP 1 Score: 231 bits (588), Expect = 5.13e-76 Identity = 119/125 (95.20%), Postives = 121/125 (96.80%), Query Frame = 0
BLAST of Csor.00g147210 vs. NCBI nr
Match: XP_022986710.1 (cyclin-dependent protein kinase inhibitor SMR13 [Cucurbita maxima]) HSP 1 Score: 228 bits (581), Expect = 5.99e-75 Identity = 118/125 (94.40%), Postives = 119/125 (95.20%), Query Frame = 0
BLAST of Csor.00g147210 vs. NCBI nr
Match: KAG7010272.1 (Cyclin-dependent protein kinase inhibitor SMR13, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 227 bits (579), Expect = 1.10e-74 Identity = 118/125 (94.40%), Postives = 118/125 (94.40%), Query Frame = 0
BLAST of Csor.00g147210 vs. NCBI nr
Match: XP_023522908.1 (cyclin-dependent protein kinase inhibitor SMR15-like [Cucurbita pepo subsp. pepo]) HSP 1 Score: 224 bits (570), Expect = 2.67e-73 Identity = 117/125 (93.60%), Postives = 117/125 (93.60%), Query Frame = 0
BLAST of Csor.00g147210 vs. ExPASy TrEMBL
Match: A0A6J1FTJ6 (cyclin-dependent protein kinase inhibitor SMR13 OS=Cucurbita moschata OX=3662 GN=LOC111448665 PE=4 SV=1) HSP 1 Score: 231 bits (588), Expect = 2.48e-76 Identity = 119/125 (95.20%), Postives = 121/125 (96.80%), Query Frame = 0
BLAST of Csor.00g147210 vs. ExPASy TrEMBL
Match: A0A6J1JET4 (cyclin-dependent protein kinase inhibitor SMR13 OS=Cucurbita maxima OX=3661 GN=LOC111484378 PE=4 SV=1) HSP 1 Score: 228 bits (581), Expect = 2.90e-75 Identity = 118/125 (94.40%), Postives = 119/125 (95.20%), Query Frame = 0
BLAST of Csor.00g147210 vs. ExPASy TrEMBL
Match: A0A0A0L0Q1 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_4G291940 PE=4 SV=1) HSP 1 Score: 147 bits (370), Expect = 3.99e-43 Identity = 89/128 (69.53%), Postives = 97/128 (75.78%), Query Frame = 0
BLAST of Csor.00g147210 vs. ExPASy TrEMBL
Match: A0A6J1D3Z6 (cyclin-dependent protein kinase inhibitor SMR15-like OS=Momordica charantia OX=3673 GN=LOC111017372 PE=4 SV=1) HSP 1 Score: 143 bits (360), Expect = 1.04e-41 Identity = 85/126 (67.46%), Postives = 95/126 (75.40%), Query Frame = 0
BLAST of Csor.00g147210 vs. ExPASy TrEMBL
Match: A0A6J1K7R4 (cyclin-dependent protein kinase inhibitor SMR9-like OS=Cucurbita maxima OX=3661 GN=LOC111491400 PE=4 SV=1) HSP 1 Score: 131 bits (329), Expect = 5.56e-37 Identity = 79/121 (65.29%), Postives = 86/121 (71.07%), Query Frame = 0
BLAST of Csor.00g147210 vs. TAIR 10
Match: AT1G51355.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: chloroplast; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G20898.1); Has 52 Blast hits to 52 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 2; Fungi - 0; Plants - 50; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 72.8 bits (177), Expect = 2.2e-13 Identity = 35/59 (59.32%), Postives = 43/59 (72.88%), Query Frame = 0
BLAST of Csor.00g147210 vs. TAIR 10
Match: AT3G20898.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G51355.1); Has 66 Blast hits to 66 proteins in 10 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 66; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 69.3 bits (168), Expect = 2.5e-12 Identity = 45/103 (43.69%), Postives = 55/103 (53.40%), Query Frame = 0
BLAST of Csor.00g147210 vs. TAIR 10
Match: AT1G60783.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G10690.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 47.8 bits (112), Expect = 7.6e-06 Identity = 28/70 (40.00%), Postives = 39/70 (55.71%), Query Frame = 0
BLAST of Csor.00g147210 vs. TAIR 10
Match: AT5G40460.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G27630.1); Has 87 Blast hits to 87 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 87; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 45.8 bits (107), Expect = 2.9e-05 Identity = 31/72 (43.06%), Postives = 40/72 (55.56%), Query Frame = 0
BLAST of Csor.00g147210 vs. TAIR 10
Match: AT1G10690.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G60783.1); Has 59 Blast hits to 59 proteins in 9 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 59; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 43.9 bits (102), Expect = 1.1e-04 Identity = 21/48 (43.75%), Postives = 28/48 (58.33%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|