![](http://cucurbitgenomics.org/sites/default/files/styles/slideshow/public/carousel/101322_web.jpg?itok=EG-G51x6)
Csor.00g113770 (gene) Silver-seed gourd (wild; sororia) v1
Overview
Sequences
The following sequences are available for this feature:
Legend: CDSsinglestart_codonpolypeptidestop_codon Hold the cursor over a type above to highlight its positions in the sequence below.ATGCCTTTAAAATGGCTGCTTCATTCAACAAGTTGCCTTCTCGGGAACCCGATCGAGGTCCCGATAAGCTCACAAGGGAAAAGGGGTTGTGAAGAAATATGCAATTCTGGGTTTCAAATGCCTCTTCATTACCCTCGTTACAACAAGGCCGATTACCAGAAGATGGAGGACTGGAAGGTGGATCTGCTTCTCAAGGAATATGGCTTGAGTTTTCATGGCAGTTTGGAGGAGAAGAGGGCCTTTGCAATGGGGGCGTTTACATGGCCTGATCAGAATTAA ATGCCTTTAAAATGGCTGCTTCATTCAACAAGTTGCCTTCTCGGGAACCCGATCGAGGTCCCGATAAGCTCACAAGGGAAAAGGGGTTGTGAAGAAATATGCAATTCTGGGTTTCAAATGCCTCTTCATTACCCTCGTTACAACAAGGCCGATTACCAGAAGATGGAGGACTGGAAGGTGGATCTGCTTCTCAAGGAATATGGCTTGAGTTTTCATGGCAGTTTGGAGGAGAAGAGGGCCTTTGCAATGGGGGCGTTTACATGGCCTGATCAGAATTAA ATGCCTTTAAAATGGCTGCTTCATTCAACAAGTTGCCTTCTCGGGAACCCGATCGAGGTCCCGATAAGCTCACAAGGGAAAAGGGGTTGTGAAGAAATATGCAATTCTGGGTTTCAAATGCCTCTTCATTACCCTCGTTACAACAAGGCCGATTACCAGAAGATGGAGGACTGGAAGGTGGATCTGCTTCTCAAGGAATATGGCTTGAGTTTTCATGGCAGTTTGGAGGAGAAGAGGGCCTTTGCAATGGGGGCGTTTACATGGCCTGATCAGAATTAA MPLKWLLHSTSCLLGNPIEVPISSQGKRGCEEICNSGFQMPLHYPRYNKADYQKMEDWKVDLLLKEYGLSFHGSLEEKRAFAMGAFTWPDQN Homology
BLAST of Csor.00g113770 vs. NCBI nr
Match: KAG6594704.1 (hypothetical protein SDJN03_11257, partial [Cucurbita argyrosperma subsp. sororia] >KAG7026671.1 hypothetical protein SDJN02_10674, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 203 bits (517), Expect = 3.39e-66 Identity = 92/92 (100.00%), Postives = 92/92 (100.00%), Query Frame = 0
BLAST of Csor.00g113770 vs. NCBI nr
Match: XP_038882557.1 (uncharacterized protein LOC120073788 [Benincasa hispida]) HSP 1 Score: 160 bits (406), Expect = 3.22e-49 Identity = 76/94 (80.85%), Postives = 81/94 (86.17%), Query Frame = 0
BLAST of Csor.00g113770 vs. NCBI nr
Match: TYK12988.1 (uncharacterized protein E5676_scaffold255G005850 [Cucumis melo var. makuwa]) HSP 1 Score: 154 bits (390), Expect = 9.44e-47 Identity = 74/96 (77.08%), Postives = 78/96 (81.25%), Query Frame = 0
BLAST of Csor.00g113770 vs. NCBI nr
Match: XP_011658113.1 (uncharacterized protein LOC105435946 [Cucumis sativus] >KGN49041.1 hypothetical protein Csa_003579 [Cucumis sativus]) HSP 1 Score: 153 bits (386), Expect = 3.84e-46 Identity = 73/97 (75.26%), Postives = 80/97 (82.47%), Query Frame = 0
BLAST of Csor.00g113770 vs. NCBI nr
Match: KAG6603827.1 (hypothetical protein SDJN03_04436, partial [Cucurbita argyrosperma subsp. sororia] >KAG7034009.1 hypothetical protein SDJN02_03735, partial [Cucurbita argyrosperma subsp. argyrosperma]) HSP 1 Score: 142 bits (357), Expect = 1.08e-41 Identity = 72/98 (73.47%), Postives = 79/98 (80.61%), Query Frame = 0
BLAST of Csor.00g113770 vs. ExPASy TrEMBL
Match: A0A5D3CP92 (Uncharacterized protein OS=Cucumis melo var. makuwa OX=1194695 GN=E5676_scaffold255G005850 PE=4 SV=1) HSP 1 Score: 154 bits (390), Expect = 4.57e-47 Identity = 74/96 (77.08%), Postives = 78/96 (81.25%), Query Frame = 0
BLAST of Csor.00g113770 vs. ExPASy TrEMBL
Match: A0A0A0KMW8 (Uncharacterized protein OS=Cucumis sativus OX=3659 GN=Csa_6G511080 PE=4 SV=1) HSP 1 Score: 153 bits (386), Expect = 1.86e-46 Identity = 73/97 (75.26%), Postives = 80/97 (82.47%), Query Frame = 0
BLAST of Csor.00g113770 vs. ExPASy TrEMBL
Match: A0A6J1BUU9 (uncharacterized protein LOC111005569 OS=Momordica charantia OX=3673 GN=LOC111005569 PE=4 SV=1) HSP 1 Score: 139 bits (350), Expect = 7.54e-41 Identity = 68/104 (65.38%), Postives = 77/104 (74.04%), Query Frame = 0
BLAST of Csor.00g113770 vs. ExPASy TrEMBL
Match: A0A7J0EYW1 (Uncharacterized protein OS=Actinidia rufa OX=165716 GN=Acr_08g0000310 PE=4 SV=1) HSP 1 Score: 124 bits (311), Expect = 6.80e-35 Identity = 60/106 (56.60%), Postives = 72/106 (67.92%), Query Frame = 0
BLAST of Csor.00g113770 vs. ExPASy TrEMBL
Match: A0A2N9EZP3 (Uncharacterized protein OS=Fagus sylvatica OX=28930 GN=FSB_LOCUS8195 PE=4 SV=1) HSP 1 Score: 122 bits (306), Expect = 3.19e-34 Identity = 58/99 (58.59%), Postives = 70/99 (70.71%), Query Frame = 0
BLAST of Csor.00g113770 vs. TAIR 10
Match: AT5G55620.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G09950.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 90.9 bits (224), Expect = 5.8e-19 Identity = 37/56 (66.07%), Postives = 49/56 (87.50%), Query Frame = 0
BLAST of Csor.00g113770 vs. TAIR 10
Match: AT3G09950.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G41761.1); Has 128 Blast hits to 128 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 128; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 87.4 bits (215), Expect = 6.4e-18 Identity = 39/70 (55.71%), Postives = 52/70 (74.29%), Query Frame = 0
BLAST of Csor.00g113770 vs. TAIR 10
Match: AT5G41761.1 (unknown protein; FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G55570.1); Has 30201 Blast hits to 17322 proteins in 780 species: Archae - 12; Bacteria - 1396; Metazoa - 17338; Fungi - 3422; Plants - 5037; Viruses - 0; Other Eukaryotes - 2996 (source: NCBI BLink). ) HSP 1 Score: 80.9 bits (198), Expect = 6.0e-16 Identity = 33/58 (56.90%), Postives = 44/58 (75.86%), Query Frame = 0
BLAST of Csor.00g113770 vs. TAIR 10
Match: AT3G55570.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT5G41761.1); Has 128 Blast hits to 128 proteins in 12 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 128; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). ) HSP 1 Score: 78.2 bits (191), Expect = 3.9e-15 Identity = 33/53 (62.26%), Postives = 41/53 (77.36%), Query Frame = 0
BLAST of Csor.00g113770 vs. TAIR 10
Match: AT3G11405.1 (unknown protein; BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT3G55570.1); Has 35333 Blast hits to 34131 proteins in 2444 species: Archae - 798; Bacteria - 22429; Metazoa - 974; Fungi - 991; Plants - 531; Viruses - 0; Other Eukaryotes - 9610 (source: NCBI BLink). ) HSP 1 Score: 55.5 bits (132), Expect = 2.7e-08 Identity = 28/54 (51.85%), Postives = 34/54 (62.96%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Silver-seed gourd (sororia) v1
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|