
CsaV3_UNG208970 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGATCTGGCATGTACAGAATGAAAACTTCATTCTCGATTCTACGAGAATTTTTATGAAAGCCTTTCATTTGCTTCTCTTCGATGGAAGTTTTATTTTCCCAGAATGTATCCTAATTTTTGGCCTAATTCTTCTTCTGATGATCGATTCAACCTCTGATCAA ATGATCTGGCATGTACAGAATGAAAACTTCATTCTCGATTCTACGAGAATTTTTATGAAAGCCTTTCATTTGCTTCTCTTCGATGGAAGTTTTATTTTCCCAGAATGTATCCTAATTTTTGGCCTAATTCTTCTTCTGATGATCGATTCAACCTCTGATCAA ATGATCTGGCATGTACAGAATGAAAACTTCATTCTCGATTCTACGAGAATTTTTATGAAAGCCTTTCATTTGCTTCTCTTCGATGGAAGTTTTATTTTCCCAGAATGTATCCTAATTTTTGGCCTAATTCTTCTTCTGATGATCGATTCAACCTCTGATCAA MIWHVQNENFILDSTRIFMKAFHLLLFDGSFIFPECILIFGLILLLMIDSTSDQ Homology
BLAST of CsaV3_UNG208970 vs. NCBI nr
Match: ARC97547.1 (NADH-plastoquinone oxidoreductase subunit 2 [Osteomeles anthyllidifolia]) HSP 1 Score: 109.4 bits (272), Expect = 9.9e-21 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. NCBI nr
Match: AQV10571.1 (NADH dehydrogenase subunit 2 [Camelina sativa] >AQV10580.1 NADH dehydrogenase subunit 2 [Camelina sativa]) HSP 1 Score: 109.4 bits (272), Expect = 9.9e-21 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. NCBI nr
Match: YP_009419449.1 (NADH-plastoquinone oxidoreductase subunit 2 [Ternstroemia gymnanthera] >YP_009419464.1 NADH-plastoquinone oxidoreductase subunit 2 [Ternstroemia gymnanthera] >ADZ36367.1 NADH-plastoquinone oxidoreductase subunit 2 [Ternstroemia gymnanthera] >ASM45799.1 NADH-plastoquinone oxidoreductase subunit 2 [Ternstroemia gymnanthera] >ASM45800.1 NADH-plastoquinone oxidoreductase subunit 2 [Ternstroemia gymnanthera]) HSP 1 Score: 109.4 bits (272), Expect = 9.9e-21 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. NCBI nr
Match: YP_010142386.1 (NADH-plastoquinone oxidoreductase subunit 2 [Persicaria japonica] >YP_010142402.1 NADH-plastoquinone oxidoreductase subunit 2 [Persicaria japonica] >QQK93019.1 NADH-plastoquinone oxidoreductase subunit 2 [Persicaria japonica] >QQK93020.1 NADH-plastoquinone oxidoreductase subunit 2 [Persicaria japonica]) HSP 1 Score: 109.4 bits (272), Expect = 9.9e-21 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. NCBI nr
Match: QXP99855.1 (NADH dehydrogenase subunit 2 [Fallopia aubertii] >QXP99871.1 NADH dehydrogenase subunit 2 [Fallopia aubertii]) HSP 1 Score: 109.4 bits (272), Expect = 9.9e-21 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. ExPASy Swiss-Prot
Match: P0CC20 (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Acorus americanus OX=263995 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.3e-23 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. ExPASy Swiss-Prot
Match: P0CC21 (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Acorus calamus OX=4465 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.3e-23 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. ExPASy Swiss-Prot
Match: P0CC46 (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Citrus sinensis OX=2711 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.3e-23 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. ExPASy Swiss-Prot
Match: P0CC50 (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Cucumis sativus OX=3659 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.3e-23 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. ExPASy Swiss-Prot
Match: P0CC64 (NAD(P)H-quinone oxidoreductase subunit 2 A, chloroplastic OS=Gossypium barbadense OX=3634 GN=ndhB1 PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 1.3e-23 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. ExPASy TrEMBL
Match: A0A7H1A7K0 (NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic OS=Solms-laubachia baiogoinensis OX=375369 GN=ndhB PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 4.8e-21 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. ExPASy TrEMBL
Match: A0A7H9SKS1 (NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic OS=Camellia fraterna OX=542725 GN=ndhB PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 4.8e-21 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. ExPASy TrEMBL
Match: A0A7G8QE82 (NADH-quinone oxidoreductase subunit N OS=Balanops balansae OX=544656 GN=ndhB PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 4.8e-21 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. ExPASy TrEMBL
Match: A0A7H1A731 (NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic OS=Sisymbriopsis schugnana OX=2259848 GN=ndhB PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 4.8e-21 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
BLAST of CsaV3_UNG208970 vs. ExPASy TrEMBL
Match: A0A649Z9L0 (NAD(P)H-quinone oxidoreductase subunit 2, chloroplastic OS=Amelanchier cusickii OX=52524 GN=ndhB PE=3 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 4.8e-21 Identity = 54/54 (100.00%), Postives = 54/54 (100.00%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
|