CsaV3_6G041420 (gene) Cucumber (Chinese Long) v3
Overview
Sequences
The following sequences are available for this feature:
Legend: exonCDSpolypeptide Hold the cursor over a type above to highlight its positions in the sequence below.ATGTCTTCTCATGTAATTTTTGGAGGTTATCGACCATGTGAGAATTCAGATGGTCCACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACATAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGAAGATGGGAGAATTTCAGGGAGCTCACATCCTTCATAGTATTCTACCCATCTTCTGGTTGACAAGGGATATCCCCTTGTAA ATGTCTTCTCATGTAATTTTTGGAGGTTATCGACCATGTGAGAATTCAGATGGTCCACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACATAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGAAGATGGGAGAATTTCAGGGAGCTCACATCCTTCATAGTATTCTACCCATCTTCTGGTTGACAAGGGATATCCCCTTGTAA ATGTCTTCTCATGTAATTTTTGGAGGTTATCGACCATGTGAGAATTCAGATGGTCCACATGCGAAAGAAGTAGCACAATGGGCAGTAACAGAATACAACATAAAACACCGCCATGAACGTCCTTACTTGTACCTTCTTAGTGTATTGAAGTGCGAGTCGCAAGTGGTGGCTGGAACCAATTGGCGTCTGGGGTTGAAGTGTAAGGATGAAAATAATATTGAGGTAAACTGTGAGGCTGTTGTGTGGGAGAAGAAGATGGGAGAATTTCAGGGAGCTCACATCCTTCATAGTATTCTACCCATCTTCTGGTTGACAAGGGATATCCCCTTGTAA MSSHVIFGGYRPCENSDGPHAKEVAQWAVTEYNIKHRHERPYLYLLSVLKCESQVVAGTNWRLGLKCKDENNIEVNCEAVVWEKKMGEFQGAHILHSILPIFWLTRDIPL* Homology
BLAST of CsaV3_6G041420 vs. NCBI nr
Match: KAE8647449.1 (hypothetical protein Csa_002967 [Cucumis sativus]) HSP 1 Score: 243.4 bits (620), Expect = 9.0e-61 Identity = 110/110 (100.00%), Postives = 110/110 (100.00%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. NCBI nr
Match: KGN44121.2 (hypothetical protein Csa_021373 [Cucumis sativus]) HSP 1 Score: 189.1 bits (479), Expect = 2.0e-44 Identity = 85/89 (95.51%), Postives = 86/89 (96.63%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. NCBI nr
Match: KAE8645927.1 (hypothetical protein Csa_021385 [Cucumis sativus]) HSP 1 Score: 178.7 bits (452), Expect = 2.7e-41 Identity = 80/90 (88.89%), Postives = 83/90 (92.22%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. NCBI nr
Match: KAE8645925.1 (hypothetical protein Csa_021376 [Cucumis sativus]) HSP 1 Score: 177.6 bits (449), Expect = 6.1e-41 Identity = 80/90 (88.89%), Postives = 82/90 (91.11%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. NCBI nr
Match: KAE8645926.1 (hypothetical protein Csa_021381 [Cucumis sativus]) HSP 1 Score: 174.9 bits (442), Expect = 4.0e-40 Identity = 80/90 (88.89%), Postives = 82/90 (91.11%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. ExPASy Swiss-Prot
Match: P86472 (Cysteine proteinase inhibitor 1 OS=Actinidia chinensis var. chinensis OX=1590841 GN=CYT1 PE=1 SV=2) HSP 1 Score: 65.1 bits (157), Expect = 5.8e-10 Identity = 37/86 (43.02%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. ExPASy Swiss-Prot
Match: Q6TPK4 (Cysteine proteinase inhibitor 1 OS=Actinidia deliciosa OX=3627 PE=1 SV=1) HSP 1 Score: 63.2 bits (152), Expect = 2.2e-09 Identity = 36/86 (41.86%), Postives = 53/86 (61.63%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. ExPASy Swiss-Prot
Match: Q41916 (Cysteine proteinase inhibitor 5 OS=Arabidopsis thaliana OX=3702 GN=CYS5 PE=2 SV=2) HSP 1 Score: 59.3 bits (142), Expect = 3.2e-08 Identity = 29/83 (34.94%), Postives = 47/83 (56.63%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. ExPASy Swiss-Prot
Match: B7PKZ1 (Salivary cystatin-L2 OS=Ixodes scapularis OX=6945 GN=IscW_ISCW018602 PE=1 SV=1) HSP 1 Score: 49.3 bits (116), Expect = 3.3e-05 Identity = 24/59 (40.68%), Postives = 36/59 (61.02%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. ExPASy Swiss-Prot
Match: Q84WT8 (Cysteine proteinase inhibitor 4 OS=Arabidopsis thaliana OX=3702 GN=CYS4 PE=3 SV=2) HSP 1 Score: 45.1 bits (105), Expect = 6.2e-04 Identity = 26/77 (33.77%), Postives = 41/77 (53.25%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. ExPASy TrEMBL
Match: A0A0A0KHK7 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G459990 PE=4 SV=1) HSP 1 Score: 177.6 bits (449), Expect = 3.0e-41 Identity = 80/90 (88.89%), Postives = 82/90 (91.11%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. ExPASy TrEMBL
Match: A0A0A0KF17 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G460000 PE=4 SV=1) HSP 1 Score: 174.1 bits (440), Expect = 3.3e-40 Identity = 80/89 (89.89%), Postives = 81/89 (91.01%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. ExPASy TrEMBL
Match: O80389 (Cystein proteinase inhibitor OS=Cucumis sativus OX=3659 PE=2 SV=1) HSP 1 Score: 109.4 bits (272), Expect = 9.9e-21 Identity = 54/90 (60.00%), Postives = 64/90 (71.11%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. ExPASy TrEMBL
Match: A0A5A7TBL3 (Cysteine proteinase inhibitor 5-like OS=Cucumis melo var. makuwa OX=1194695 GN=E6C27_scaffold529G00310 PE=4 SV=1) HSP 1 Score: 104.8 bits (260), Expect = 2.4e-19 Identity = 52/89 (58.43%), Postives = 63/89 (70.79%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. ExPASy TrEMBL
Match: A0A0A0KHN6 (Cystatin domain-containing protein OS=Cucumis sativus OX=3659 GN=Csa_6G482230 PE=4 SV=1) HSP 1 Score: 93.6 bits (231), Expect = 5.6e-16 Identity = 50/102 (49.02%), Postives = 63/102 (61.76%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. TAIR 10
Match: AT5G47550.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 59.3 bits (142), Expect = 2.3e-09 Identity = 29/83 (34.94%), Postives = 47/83 (56.63%), Query Frame = 0
BLAST of CsaV3_6G041420 vs. TAIR 10
Match: AT4G16500.1 (Cystatin/monellin superfamily protein ) HSP 1 Score: 45.1 bits (105), Expect = 4.4e-05 Identity = 26/77 (33.77%), Postives = 41/77 (53.25%), Query Frame = 0
The following BLAST results are available for this feature:
InterPro
Analysis Name: InterPro Annotations of Cucumber (Chinese Long) v3
Date Performed: 2021-10-25
Relationships
The following mRNA feature(s) are a part of this gene:
GO Annotation
GO Assignments
This gene is annotated with the following GO terms.
|